DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and Frmpd2

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_017171733.1 Gene:Frmpd2 MGIID:2685472 Length:1292 Species:Mus musculus

Alignment Length:753 Identity:144/754 (19%)
Similarity:220/754 (29%) Gaps:328/754 (44%)


  Fly    20 NGLGFILVGGRS-----TGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQ 79
            :|.||::..|..     :|:.|.:|.|||.|||..:::.|..:|.:..::|.||:......:::.
Mouse   786 HGFGFVINEGEDAEQTRSGIFISSLIPGGPAERAKKIKPGGKILALNHISLEGFTFSMAVRMIQN 850

  Fly    80 TGAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELSRHLFQNPSFATAAVAAAAAAAAA 144
            :...:.||:::|                                                     
Mouse   851 SPDDMELIISQP----------------------------------------------------- 862

  Fly   145 AGSGSDGDVGGGGVLDVASLVGLVRGGPAEGTELSAVEPQPSAAVLQLQQLSELAGDLADFPLPP 209
                             ..:.|.:.......|..|.:                            
Mouse   863 -----------------KGVCGTIHSEEKNSTASSGM---------------------------- 882

  Fly   210 IPGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPPPRPALQMLPLETQWRCVQDQNRHIETVIA 274
                    ..||                   |||.               ||...|:.||.    
Mouse   883 --------FCTD-------------------ILSN---------------RCQGRQSPHIH---- 901

  Fly   275 DSKRKLLANEDGGSASASGSGS-PDSYMDSPETETYVVELHKNVYGLGITVAGYVCEEEDLSGIF 338
            |..|.:     .|:..|.|:|| |.|.:.:...|.|.|||.|....||.:|.|.:.......||:
Mouse   902 DQDRSV-----RGTEMAQGAGSCPPSPLQTNTGEIYFVELVKEDGTLGFSVTGGINTSVPHGGIY 961

  Fly   339 VKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHL 403
            |||||.|..|...|||...||::.|||.||.|:|:.|||:.|:....|..|.|||  ||.:    
Mouse   962 VKSIIPGGPAAKEGQILQGDRLLQVDGVSLCGLTHKQAVQCLKGPGQVARLVLER--RGPR---- 1020

  Fly   404 QVALTEIKGTSAPSGLDRSQDKDQDQESQLSMPGSPSIATLSWLPPKSLDADSIA-TEGDEAVDA 467
                   .....||..||..|.........:.||.|              |.|:: |:|.:    
Mouse  1021 -------AAPQCPSADDRMGDVHMAVSLVTARPGRP--------------ASSVSVTDGPK---- 1060

  Fly   468 EYVGISGAEDEFIELPSRDTVESNMSHVLDRSDHSGGLTKDQVPRISPIVPLTNGRSLILADDSG 532
                        .|:.            |.::....|.:..|:.|                   |
Mouse  1061 ------------FEVK------------LKKNSRGLGFSFVQMER-------------------G 1082

  Fly   533 NDTDEQCAEPETETAQARKGSKPETERVKDLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTA 597
            |     |...:::..:.::                        |.|||                 
Mouse  1083 N-----CIHTKSDLVRIKR------------------------LFPGQ----------------- 1101

  Fly   598 ASLRVAWKSLGISLEGTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLR 662
                                                   |....|.:..||.:|.||...::||.
Mouse  1102 ---------------------------------------PAEEHGAIAAGDIILAVNGKPIEGLA 1127

  Fly   663 HIEVVKILKELPARVKLVCARGTHVPSVINTSQNPE---AFETRSLLPGGHQSLQNLLSKAQSES 724
            ..||:.:|:..|..|.|:..|..  |.::     ||   .::|..|  .|.|.| .:.:.|.||.
Mouse  1128 FQEVLHLLRGAPEEVTLLLCRPP--PGIL-----PEMEPGWQTPEL--SGDQRL-TMATCAGSEQ 1182

  Fly   725 SLYTSSTATLTDAGAAAGGSGGTAGGGARSKSLENVSG 762
            |..........|:.:...|.|.:.|..:..|.:..|.|
Mouse  1183 SPSLDQEDNWRDSTSLDAGEGLSPGPESSYKDVRQVKG 1220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 20/74 (27%)
PDZ 307..393 CDD:214570 39/86 (45%)
PDZ_signaling 605..680 CDD:238492 15/75 (20%)
PDZ 773..858 CDD:214570
Frmpd2XP_017171733.1 PKc_like 6..188 CDD:304357
Nha1_C 183..>235 CDD:285783
B41 334..538 CDD:214604
FERM_N 334..396 CDD:286467
FERM_M 426..538 CDD:278785
PH-like 534..635 CDD:302622
PDZ_signaling 775..859 CDD:238492 20/73 (27%)
PDZ 930..1018 CDD:214570 41/90 (46%)
PDZ 1061..1150 CDD:214570 28/205 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.