DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and let-413

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001023851.1 Gene:let-413 WormBaseID:WBGene00002632 Length:699 Species:Caenorhabditis elegans

Alignment Length:111 Identity:32/112 (29%)
Similarity:49/112 (44%) Gaps:21/112 (19%)


  Fly     3 LSTEWSQVEVIDLINDGNG-LGFILVGGRS----------TGVVIKALTPGGVAERDGRLQLGDH 56
            |:.....:..|.:..|..| ||....||.|          :|:.:..:|||..|.|.| |:.||.
 Worm   559 LAAGTQNMHTIRIQKDDTGKLGLSFAGGTSNDPAPNSNGDSGLFVTKVTPGSAAYRCG-LREGDK 622

  Fly    57 LLQIGEVNLRGFSSEQVATVL--RQTGAQVRLIVAR----PVEPTA 96
            |::..:||:...|.:.....:  |:|   |.|:|.|    ||..|:
 Worm   623 LIRANDVNMINASQDNAMEAIKKRET---VELVVLRRSPSPVSRTS 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 26/85 (31%)
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
let-413NP_001023851.1 LRR_8 13..71 CDD:290566
LRR_RI 37..349 CDD:238064
leucine-rich repeat 38..60 CDD:275380
LRR_8 59..117 CDD:290566
leucine-rich repeat 61..83 CDD:275380
leucine-rich repeat 84..106 CDD:275380
leucine-rich repeat 107..129 CDD:275380
LRR_8 128..186 CDD:290566
leucine-rich repeat 130..152 CDD:275380
leucine-rich repeat 153..175 CDD:275380
LRR_8 174..232 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..221 CDD:275380
leucine-rich repeat 222..244 CDD:275380
leucine-rich repeat 245..265 CDD:275380
leucine-rich repeat 268..290 CDD:275380
leucine-rich repeat 291..313 CDD:275380
LRR_8 312..370 CDD:290566
leucine-rich repeat 314..336 CDD:275380
leucine-rich repeat 360..382 CDD:275380
PDZ_signaling 567..654 CDD:238492 27/91 (30%)
DegQ <590..659 CDD:223343 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.