DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and smz-2

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_491965.1 Gene:smz-2 WormBaseID:WBGene00020661 Length:274 Species:Caenorhabditis elegans

Alignment Length:193 Identity:51/194 (26%)
Similarity:76/194 (39%) Gaps:64/194 (33%)


  Fly    21 GLGFILVGGRSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLR----QTG 81
            |||......|   |::..:.||.:||:  .|.|||||..:..:.:   |.:.||..|.    |..
 Worm   124 GLGIKHFQNR---VLVSRVDPGSLAEK--CLVLGDHLCDVDGIPV---SDKDVARDLLVKNIQEK 180

  Fly    82 AQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELSRHLFQNPSFATAAVAAAAAAAAAAG 146
            .:|..:|.|   |.:||.:..|.||             |:.:|.|.||..               
 Worm   181 GKVTFVVER---PDSIDAKQWAKQA-------------LATNLMQPPSVQ--------------- 214

  Fly   147 SGSDGDVGGGGVLDVAS-----LVGLVRGGPAEGTELSAVEPQPSA---AVLQLQQLSELAGD 201
              .:.||.|     :||     |.||  ..||:    ||:...|:|   ::::..|..|:..|
 Worm   215 --MNEDVKG-----IASQYRQALPGL--KPPAK----SAMSTGPNARRVSIIEQTQTHEIGHD 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 22/72 (31%)
PDZ 307..393 CDD:214570
PDZ_signaling 605..680 CDD:238492
PDZ 773..858 CDD:214570
smz-2NP_491965.1 PDZ_signaling 7..77 CDD:238492
PDZ_signaling 114..188 CDD:238492 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.