DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15803 and grip1

Sequence 1:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_004912987.1 Gene:grip1 XenbaseID:XB-GENE-853011 Length:1137 Species:Xenopus tropicalis

Alignment Length:965 Identity:193/966 (20%)
Similarity:325/966 (34%) Gaps:302/966 (31%)


  Fly     3 LSTEWSQVEVIDLI-NDGNGLGFILVGG--RSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVN 64
            ::.|:....:::|: .:|..||..:.||  :.....:..|..||:|.|..:|.:||::..:..:|
 Frog    70 ITEEFKGSTIVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLNVGDYIKAVNGIN 134

  Fly    65 LRGFSSEQVATVLRQTGAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELSRHLFQNPS 129
            |..|..:::.::|:..|.:|.|.|...:.|.:|.           .|.::....|::.|      
 Frog   135 LTKFRHDEIISLLKNVGERVVLEVEYELPPVSIQ-----------GTGVIFKTVEVTLH------ 182

  Fly   130 FATAAVAAAAAAAAAAGSGSDGDVGGGGVLDVASLVGLVRGGPAEGTELSAVEPQPSAAVLQLQQ 194
                               .:|:..|          .::|||..|....|.              
 Frog   183 -------------------KEGNTFG----------FVIRGGAHEDRNKSR-------------- 204

  Fly   195 LSELAGDLADFPLPPI------PGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPPPRPALQML 253
                          ||      |||     ..|.....:|..|| |.:....:.......|:.:|
 Frog   205 --------------PIVITCVRPGG-----PADREGTIKPGDRL-LSVDGIRLHGTTHAEAMSIL 249

  Fly   254 PLETQWRCVQDQNRHIE--TVIADSKRKLLANEDGGSASASGSGSPDSYMDSPETETYVVELHK- 315
            .     :|.|:....||  ..:.|:           .:||||              ..:||:.| 
 Frog   250 K-----QCGQEATLLIEYDVSVMDT-----------VSSASG--------------PLLVEVAKT 284

  Fly   316 --NVYGLGITVAGYVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVE 378
              :..|:.:|.:.|..::.    |.:..|...|.|:..|.:.|.|.|::|||.|:...|..:|.:
 Frog   285 PGSNLGVALTTSMYYNKQV----IVIDKIKSASIADRCGALHIGDHILSVDGTSMEYCTLAEATQ 345

  Fly   379 LLRNTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQLSMPGSPSIAT 443
            ||.:|.  .|:.||..    .|...::||   ||..... :.||.|:.                 
 Frog   346 LLASTS--EHVKLEIL----PYHQTRLAL---KGPDHVK-VQRSNDRQ----------------- 383

  Fly   444 LSWLPPKSLDADSIATEGDEAVDAEYVGISGAEDEFIELPSRDTVESNMSHVLDRSDH-SGGLTK 507
                ||::..|:|.:                      .||:  ....|..|   ..|| .....|
 Frog   384 ----PPRNFSANSHS----------------------RLPT--CQHYNTYH---HPDHCRTPAMK 417

  Fly   508 DQVPRISPIVPLTNG---------------------RSLILADDSGNDTDEQCAEPETETAQARK 551
            .|.|....::||.:.                     |||......|             |...|:
 Frog   418 CQKPPPQKLLPLVSSSFSPTSMSAYSLSSLNTGTLPRSLYPTSPRG-------------TLMRRR 469

  Fly   552 GSKPETERVKDLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISLEGTVD 616
            ..|.:.:....|..:....       .||:....:...|..|.|..        ..||.|:|:|.
 Frog   470 MKKKDFKSSLSLASSTVGL-------AGQVVHTESTEVVLTADPVL--------GFGIQLQGSVF 519

  Fly   617 VECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKE--LPARVKL 679
            ....:...|  .|..|.||.|..|.|||:.||.::.:|..:.:.....|..::|::  :..:|.|
 Frog   520 ATETLSSPP--LISYIDADSPAERCGILQVGDRVIAINGVQTEDSTFEEANQLLRDSTIAGKVTL 582

  Fly   680 VCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQSESSLYTSSTATLTD--AGAAAG 742
                  .:...:..|..|.:......||..|.  ..|.....|.|:..|.....::|  .|:.|.
 Frog   583 ------EIEFDVAESVIPSSGTFHVKLPKKHN--VELGITISSPSTRKTGDPLVISDIKKGSVAH 639

  Fly   743 GSGGTAGGGARSKSLENV---------SGLALWSCE-----------------------VTAVDI 775
            .: ||...|.:..:::|:         :...|..||                       :..|::
 Frog   640 RT-GTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEELVKLKIRKDEDNSDEQESSGAIIYTVEL 703

  Fly   776 EKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGLELDEAV 840
            ::.....|.:|...::|.|.    |:|..|.:||.||.|..|:.|||::::....|:|..|.||:
 Frog   704 KRYGGPLGITISGTEEPFDP----IIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAI 764

  Fly   841 SILK---------------AMPPGLTRLGICRPLSASDSNSNSNIASPLGDSTST 880
            .:|:               |..|.|:...|.....|.|....:..:|.|.|..||
 Frog   765 HLLQMAGETVTLKIKKQTDATSPKLSSGRISELCDAEDETPVTQKSSNLSDIYST 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 21/74 (28%)
PDZ 307..393 CDD:214570 26/89 (29%)
PDZ_signaling 605..680 CDD:238492 22/77 (29%)
PDZ 773..858 CDD:214570 27/100 (27%)
grip1XP_004912987.1 PDZ_signaling 80..159 CDD:238492 22/79 (28%)
PDZ_signaling 178..261 CDD:238492 24/157 (15%)
PDZ_signaling 276..359 CDD:238492 26/89 (29%)
PDZ_signaling 499..585 CDD:238492 25/102 (25%)
PDZ_signaling 598..682 CDD:238492 17/87 (20%)
PDZ_signaling 698..779 CDD:238492 23/85 (27%)
PDZ_signaling 1009..1089 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.