DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8064 and CG16896

DIOPT Version :8

Sequence 1:NP_650705.1 Gene:CG8064 / 42196 FlyBaseID:FBgn0038597 Length:922 Species:Drosophila melanogaster
Sequence 2:NP_611973.2 Gene:CG16896 / 37977 FlyBaseID:FBgn0035073 Length:988 Species:Drosophila melanogaster

Alignment Length:861 Identity:172/862 (20%)
Similarity:289/862 (34%) Gaps:267/862 (31%)


  Fly   260 TIQRAGKGRTVNLVTDPSERVISCHG--TNDLI-----ENFYICTPDEVKK---RLAKRLKKEKK 314
            ||:.||:...:.:..       .|..  :|.|:     .|.::.  |.|:|   ||..|:.|.|.
  Fly   102 TIKEAGQALRIQIAA-------CCFNELSNKLVVIDKRGNVFVF--DFVRKRYWRLGFRMPKAKL 157

  Fly   315 VAED--EGSDEAKLSTEQSLSDEIKRLESIRAKQKIKSIDVVLGQN--QELRVLVSLAN--NSLC 373
            :...  .|||       ..:.::...:.:|.....|..:|..:|..  :||....||.|  :|:.
  Fly   158 IRPSPLHGSD-------YIVGNKTGHIFTIDVDNSILGVDGEVGSAALEELSWSNSLQNARSSIA 215

  Fly   374 LY-----SLEASIKTRKAT-----DPSAKLLRSLTRLGHQSEVRSVCFSNDSLAIGSG------- 421
            |.     :|..::.|.:.:     |.|...|:....|.| |:...:.||||||.:.|.       
  Fly   216 LMRFGSDALLVNLHTLEVSHQLDFDQSRYTLKFAAFLPH-SDQFFIGFSNDSLHVWSSHSLSTLR 279

  Fly   422 AGESFKFWDRDAMQCLRTVPT----------------------------DY----ILCSKFVPGD 454
            .|:..|..:|.    ||.:|.                            |:    :|...|.|..
  Fly   280 MGQPIKARNRK----LRLLPAAESIPEIVLRSPDDSDLEEDLTFDCQHYDFADGMLLSYCFTPDG 340

  Fly   455 RYVLLGMKSGKLLIVDVAAADIVEEIPAHEGELWSIAILPDQKGCVTGSGDTT------------ 507
            ..:.|....|.||::.||:.|:.:.....:..|..:|.|...|..:. .|.||            
  Fly   341 NKMCLSTLDGYLLLLSVASFDLEKMYRLTDFTLHQMAFLSQPKERIV-FGITTRNQAVMLDLANT 404

  Fly   508 -------------------------------VKIW-TFELIDAGEGAAQTKVLSLLHKNTLKLEE 540
                                           |.:| |..:.:|.:  ||.:.||.: |:|.|...
  Fly   405 DHKLIVQRSNARSLSLSRDGKLLSVTSRCGEVNVWSTCRIFNALQ--AQIRCLSQV-KSTFKQPN 466

  Fly   541 TVLCLAVSPDMKYLAVGLLDATVKVFFLDTFKFYLSLYGHKLPVICLD-----------ISYDSN 594
            .:...:|...:......||:.......|..:..|...|.:.:....||           |...:.
  Fly   467 PLPPCSVGGGVSKELRDLLNPQRLKTMLKEYGCYPEKYRYLIWTSLLDLPCNGPQFQELIKLGAP 531

  Fly   595 LIVTGSAD----RN-------VKVWGLNFGDCHRSIFAHDDSVMSVQFIPRTHMFFTCGKDGKVK 648
            |:|...|.    ||       :|:|......|  .:.||.|      |:|  |:.|..     ||
  Fly   532 LLVRNRAKKLKIRNDHQRRVVIKIWSCLAQWC--KVLAHAD------FMP--HLIFPF-----VK 581

  Fly   649 QWDGDN---FEKILTLP-GHIGEAYCLSVSPNGRYLVTCGS-----DRTLRMFERTDETIVLKD- 703
            :...::   ||.|.||. .|....:.....|...||..|.:     |..|..|.::.| ::.|| 
  Fly   582 RMPKNSLVCFELIATLVLNHFQLCFEFHPLPPSNYLAMCENILQHCDEQLCKFYKSQE-MLPKDF 645

  Fly   704 ----VQEEEREQMENEQLATGEDNTV---PLLPG--------------LKMPSRKTV---GSEQS 744
                :.....|.:|.||..:..||..   |..|.              |::|.:::|   ..:|:
  Fly   646 AWPLLSTAFSEVLEEEQWLSLWDNIFSEPPWFPVFLVVAYNLINREIILRLPDKRSVLFFFHDQN 710

  Fly   745 AESILECLEISKQFELEAEEKPELHP--LMQALQ----------VKNPEDFL-------VSTL-- 788
            ...|.:.|  ||..:|.::....|||  .|....          :|.|.:::       ||.:  
  Fly   711 PVDISKLL--SKARKLMSKCALALHPQRFMTHFSPIPKGVYPKFLKYPSEWIDEQEYQAVSLIKH 773

  Fly   789 -----MRIRASDLEEALLLLPFSTVCEVLERLPTLLTQRPDQLELLCRVTIFLFKVHMKPISAAK 848
                 .|||..:|||.          :::|||.|.|.|......|.....::...:|.:......
  Fly   774 NQEIDARIRHLELEEV----------KIMERLETGLKQEEHARRLKEMERVYQDTIHREEERITC 828

  Fly   849 NMKPLLVKLLSMLKR---------DVGQLRDVLGWNLHGLALLQTEVEQRDGVQLFREATQTRKK 904
            ..|.||...:.:.:|         :..|.|.:|              |....:.|...:.:..::
  Fly   829 QRKMLLTYQMEVRRRKSEVITKLQESEQRRKIL--------------EMEKDMDLLMHSIERERR 879

  Fly   905 RDKKRREASKRRLQIQ 920
            |..:..:.::..::.|
  Fly   880 RHNQEMQLAEDEIRNQ 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8064NP_650705.1 WD40 <45..288 CDD:225201 6/30 (20%)
WD40 60..511 CDD:295369 70/359 (19%)
WD40 repeat 69..108 CDD:293791
WD40 repeat 113..149 CDD:293791
WD40 repeat 156..194 CDD:293791
WD40 repeat 200..236 CDD:293791
WD40 331..702 CDD:225201 101/499 (20%)
WD40 repeat 349..398 CDD:293791 14/63 (22%)
WD40 401..693 CDD:238121 83/406 (20%)
WD40 repeat 408..441 CDD:293791 12/40 (30%)
WD40 repeat 446..482 CDD:293791 10/36 (28%)
WD40 repeat 487..535 CDD:293791 16/92 (17%)
WD40 repeat 543..578 CDD:293791 5/35 (14%)
WD40 repeat 584..621 CDD:293791 11/59 (19%)
WD40 repeat 626..662 CDD:293791 11/39 (28%)
WD40 repeat 669..692 CDD:293791 6/28 (21%)
Utp12 780..882 CDD:281932 24/125 (19%)
CG16896NP_611973.2 WD40 228..>467 CDD:225201 49/248 (20%)
BAR 766..>952 CDD:299863 27/155 (17%)
SPFH_like <817..909 CDD:302763 12/94 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150402862
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19853
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.