DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx24

DIOPT Version :10

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_083670.1 Gene:Snx24 / 69226 MGIID:1916476 Length:169 Species:Mus musculus


Alignment Length:141 Identity:40/141 - (28%)
Similarity:62/141 - (43%) Gaps:32/141 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WIHSFTVTDTQEHKGGYTIYKITSIVFPRSVPQALTCLVVWKRFHDVKRLHRELSRRHKSLQLPG 72
            :|.||...|:...: |||::||..::..|.       ..|.||:.:...||::|.:..|:.::|.
Mouse     4 YIPSFRHEDSDLER-GYTVFKIEVLMNGRK-------HFVEKRYSEFHALHKKLKKCIKTPEIPS 60

  Fly    73 K-----LPVPTD------STYFKRFDAAVIQRRKEYILQLLDFA-AQH-PALYK---CSTFTQFF 121
            |     :|...:      .||.:    |||...:|.....|||. .:| |:|.|   |.:    |
Mouse    61 KHVRNWVPKVLEQRRQGLETYLQ----AVILENEELPKLFLDFLNVRHLPSLPKAESCGS----F 117

  Fly   122 QETPSPNGSPL 132
            .||.|...|.|
Mouse   118 DETESEESSKL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 35/131 (27%)
MIT_SNX15 241..315 CDD:239140
Protein Kinases, catalytic domain 343..665 CDD:473864
Snx24NP_083670.1 PX_SNX22 1..111 CDD:132790 32/118 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.