DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and snx22

DIOPT Version :10

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001038839.2 Gene:snx22 / 561624 ZFINID:ZDB-GENE-060825-154 Length:220 Species:Danio rerio


Alignment Length:85 Identity:24/85 - (28%)
Similarity:34/85 - (40%) Gaps:19/85 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RFHDVKRLHRELSRRHKSLQLPGKLP-VPTDSTYFKRFDAAVIQRRKE---YI-----------L 99
            |.|.|.|.|.|....|:.::...::| .|:......| ...:.|||:|   ||           .
Zfish    41 RKHFVLRRHGEFQTLHRKVKKILRVPDFPSKRNQHLR-TKPLEQRRQELEDYIQVILYQNDVVPQ 104

  Fly   100 QLLDFAAQ---HPALYKCST 116
            :||||...   ||....||:
Zfish   105 ELLDFLQVKHFHPTSKNCSS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 24/85 (28%)
MIT_SNX15 241..315 CDD:239140
Protein Kinases, catalytic domain 343..665 CDD:473864
snx22NP_001038839.2 PX_SNX22 11..121 CDD:132790 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.