DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx22

DIOPT Version :10

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001020783.1 Gene:Snx22 / 382083 MGIID:2685966 Length:192 Species:Mus musculus


Alignment Length:126 Identity:25/126 - (19%)
Similarity:54/126 - (42%) Gaps:20/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QEHKGGYTIYKITSIVFPR--SVPQALTCLVVWKRFHDVKRLHRELSRRHKSLQLPGK-LP---- 75
            |..:.|:.::::..:...|  :||         :|:.:...||:.:.:|:|....|.| ||    
Mouse    18 QSPEKGHMVFQVEVLYSGRRHTVP---------RRYSEFHALHKRIKKRYKVPDFPSKRLPNWRT 73

  Fly    76 --VPTDSTYFKRFDAAVIQRRKEYILQLLDF-AAQH-PALYKCSTFTQFFQETPSPNGSPL 132
              :.......:.:...::...::...:||:| ..:| |...|.|:::...:..||...|.|
Mouse    74 RGLEQRRQGLETYIQGILYLNQDVPKELLEFLRLRHFPTDSKTSSWSTLGEFLPSDTSSQL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 21/116 (18%)
MIT_SNX15 241..315 CDD:239140
Protein Kinases, catalytic domain 343..665 CDD:473864
Snx22NP_001020783.1 PX_SNX22 2..115 CDD:132790 19/105 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.