DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7156 and Snx21

DIOPT Version :10

Sequence 1:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster


Alignment Length:185 Identity:44/185 - (23%)
Similarity:67/185 - (36%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DKLDLPYDPHDAGGITPLDPRCDKEQTNNESQAKETEIELETKQEPKTDVALTKR-DYLRLLTPM 232
            |:||.|.....|..|.|  |..||     ..|....|.....:.:|.||.:...| |.|     :
  Fly    25 DELDSPAIEAAALDIPP--PESDK-----ALQKGVWERATSAEYKPTTDGSTVLRFDIL-----L 77

  Fly   233 ASIESDDSD-------YIYEAALEFSHAVQ----AEVNLEYAEAHERY-----KHGVDL------ 275
            |.|...|.:       .:||..::...|.:    |::...|.:..|.|     :|..::      
  Fly    78 AHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFP 142

  Fly   276 ---LLNGAKQDSSEERRFIAKAKIAKYLA-----RAEEIHANFLANDCPTKKLQF 322
               |:...|.:...||....:|.:. |:|     |..|....||.:|..|:..||
  Fly   143 AKVLMGNFKSELIGERSAAFEAFLT-YVASQAMLRDSEYFLRFLQHDELTRACQF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 19/103 (18%)
Protein Kinases, catalytic domain 343..665 CDD:473864
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 25/122 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.