DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and RPF2

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_013007.1 Gene:RPF2 SGDID:S000001789 Length:344 Species:Saccharomyces cerevisiae

Alignment Length:302 Identity:118/303 (39%)
Similarity:179/303 (59%) Gaps:11/303 (4%)


  Fly     3 LLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKND 67
            ::|..|||..:.|:.|:.||.:|:|:.:..||:.|:.|..|:...|.||.|||||.:|..|||||
Yeast     1 MIRTVKPKNARAKRALVKREAKLVENVKQALFIPGQSCNKNLHDIMVDLSALKKPDMKRFNRKND 65

  Fly    68 ITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGI-KRYQAISEFKN 131
            |.||:|.|.|||.:.|||.:|....::||||.:|:...|.|..::.||.||.: ..::.:|:||.
Yeast    66 IHPFEDMSPLEFFSEKNDCSLMVLMTSSKKRKNNMTFIRTFGYKIYDMIELMVADNFKLLSDFKK 130

  Fly   132 EKIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDM----- 191
            ......:||...|.|..:......:::::||:|.|:.|..|...:.|::||:|.|:..|.     
Yeast   131 LTFTVGLKPMFTFQGAAFDTHPVYKQIKSLFLDFFRGESTDLQDVAGLQHVISMTIQGDFQDGEP 195

  Fly   192 --NILMRSYRILLKKS---GQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKK 251
              |:|.|.|::...||   |:|.|||||.||||..||.|.|....|.|:..:|.|:||||::..|
Yeast   196 LPNVLFRVYKLKSYKSDQGGKRLPRIELVEIGPRLDFKIGRIHTPSPDMVTEAHKKPKQLEMKTK 260

  Fly   252 KNISTDALGNTKGRVHLGKQQTGSIQTRRVKALRKTPEEKKE 293
            ||:..|.:|:..||:|:|||..|.:|||::|.|:...::..|
Yeast   261 KNVELDIMGDKLGRIHMGKQDLGKLQTRKMKGLKSKFDQGTE 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 117/298 (39%)
RPF2NP_013007.1 RPF2 1..324 CDD:227437 118/303 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249584969
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 220 1.000 Inparanoid score I762
Isobase 1 0.950 0 Normalized mean entropy S877
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1136306
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.