DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and RPF2

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_115570.1 Gene:RPF2 HGNCID:20870 Length:306 Species:Homo sapiens

Alignment Length:303 Identity:142/304 (47%)
Similarity:202/304 (66%) Gaps:2/304 (1%)


  Fly     2 SLLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKN 66
            :|.|:.||||::.|:.|..|||:|.|:.:..:.:.|......|...:||:.|||||...:..:||
Human     3 TLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKN 67

  Fly    67 DITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKN 131
            ...||:|.:||||.:.|:|.:||.|||.:||||:|:::||:::..||||.||||:.:.::.:.||
Human    68 ITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKN 132

  Fly   132 EKIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMR 196
            .|.....||.|:|.|..:..||:.|||::|.||.|:...|.:|||.|:|:||.||..:. .|..|
Human   133 SKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNG-KIYFR 196

  Fly   197 SYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGN 261
            ||::||||||.|||||||||:|||.|..:|||.:||:||||.:.|.||.||..||||||.|..|.
Human   197 SYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGT 261

  Fly   262 TKGRVHLGKQQTGSIQTRRVKALRKTPEEK-KENRQRKKVALK 303
            |.||:|:.||....:|||::|.|:|.|.|: .|:.::|...:|
Human   262 TYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIK 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 138/287 (48%)
RPF2NP_115570.1 Brix 6..297 CDD:321259 139/292 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249578021
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 276 1.000 Inparanoid score I2920
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D434863at33208
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1073947
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.