DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and AT3G23620

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_566734.1 Gene:AT3G23620 AraportID:AT3G23620 Length:314 Species:Arabidopsis thaliana

Alignment Length:307 Identity:101/308 (33%)
Similarity:171/308 (56%) Gaps:14/308 (5%)


  Fly     3 LLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKK-PLVKVLNRKN 66
            ::.||.|||.|.|:||.:|.|:|:|:.:..|.|.|.|....:...|.:|..||| ..::...|..
plant     1 MMEIRTPKTGKAKRVLESRAPKLVETGKKTLILHGTKTSATLSSVMTELYRLKKGGAIRYSRRNE 65

  Fly    67 DITPFDD--PSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEF 129
            :|.||:.  .:||||.:.|.|.::|.:||.:||||||::|||:::::|.|:.|:||:.::::..|
plant    66 NIRPFESGGETSLEFFSQKTDCSIFVYGSHTKKRPDNLVLGRMYDHQVYDLIEVGIENFKSLRAF 130

  Fly   130 KNEKIGA---CVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDM 191
            ..:|..|   ..||.:.|.|..:....||:.|:.:..|.|:.|.||::.|.|::.....:.....
plant   131 SYDKKFAPHEGTKPFICFIGEGFENVSELKHLKEVLTDLFRGEVVDNLNLTGLDRAYVCSAISPT 195

  Fly   192 NILMRSYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNIST 256
            .:.:....:.|||||...||:||.|:|||.|..|||.::.::.|.|:|.:..|.....|:||:..
plant   196 KVFLTHCALKLKKSGSIVPRMELVEVGPSMDLVIRRNRLPNDSLMKEAMRTSKDKPKKKEKNVDQ 260

  Fly   257 DALGNTKGRVHLGKQQTGSIQTRRVKALRKTPEEKKENRQRKKVALK 303
            ||:....|::::..|        ::|.::...:.|...|:||...||
plant   261 DAVLGKTGKIYMPDQ--------KLKEMKLFDKSKGSKRERKDAKLK 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 95/293 (32%)
AT3G23620NP_566734.1 Brix 1..291 CDD:294606 96/298 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 184 1.000 Inparanoid score I1386
OMA 1 1.010
OrthoDB 1 1.010 D974865at2759
OrthoInspector 1 1.000 T192498
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.