DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and Rpf2

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_075812.3 Gene:Rpf2 MGIID:1914489 Length:306 Species:Mus musculus

Alignment Length:298 Identity:137/299 (46%)
Similarity:198/299 (66%) Gaps:1/299 (0%)


  Fly     2 SLLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKN 66
            :|.::.||||::.|:.|..|||:|.|:.:..:.:.|......|...::|:.|||||...:..:||
Mouse     3 ALDKVLKPKTKRAKRFLEKREPKLTENIKNAMLIKGGNANATVTQVLRDMYALKKPYGVLYKKKN 67

  Fly    67 DITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKN 131
            ...||:|.:||||.:.|:|.:||.|||.:||||:|:::||:::..||||.||||:::.::.:.|.
Mouse    68 ITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKT 132

  Fly   132 EKIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMR 196
            .|.....||.|:|.|..:..||:.|||:||.||.|:...|.::||.|:|:||.||..:. .:..|
Mouse   133 SKCPEGTKPMLIFAGDDFDVTEDFRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNG-KVYFR 196

  Fly   197 SYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGN 261
            ||::||||||.|||||||||:|||.|..:|||.:||:||||.:.|.||.||..|:||||.|..|.
Mouse   197 SYKLLLKKSGCRTPRIELEEMGPSLDLVMRRTHLASDDLYKLSMKVPKALKPKKRKNISQDTFGT 261

  Fly   262 TKGRVHLGKQQTGSIQTRRVKALRKTPEEKKENRQRKK 299
            |.||:|:.||....:|||::|.|:|.|.|...:.|.||
Mouse   262 TFGRIHMQKQDLSKLQTRKMKGLKKRPAENGVDDQGKK 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 133/287 (46%)
Rpf2NP_075812.3 Brix 6..286 CDD:294606 130/281 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249578428
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 273 1.000 Inparanoid score I2956
Isobase 1 0.950 0 Normalized mean entropy S877
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1084035
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.