DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and rpf2

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001008430.2 Gene:rpf2 XenbaseID:XB-GENE-967404 Length:308 Species:Xenopus tropicalis

Alignment Length:289 Identity:138/290 (48%)
Similarity:194/290 (67%) Gaps:1/290 (0%)


  Fly     5 RIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKNDIT 69
            |:.||||::.|:....|||:|.|:.:..:.:.|......|...:||:.|:|||...:..:||...
 Frog     6 RVVKPKTKRSKRFQEHREPKLNENIKNAMLIKGGNANNTVTQALKDIYAIKKPYAVLYKKKNMTR 70

  Fly    70 PFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKNEKI 134
            ||:|.:||||...|:|.:||.|||.:||||:::|.||:::..||||.|||:::|.::.|.||.|.
 Frog    71 PFEDQTSLEFFAKKSDCSLFIFGSHNKKRPNDLIFGRMYDYHVLDMIELGVEKYVSLKEIKNCKC 135

  Fly   135 GACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMRSYR 199
            ....||.|:|.|..:..:|:.|||::||||.|:...|..:||.|:||||.||..|. .:.||||:
 Frog   136 PEGTKPLLIFAGDAFEMSEDYRRLKSLFIDFFRGPTVSGVRLAGLEHVLHFTAVDG-KVFMRSYK 199

  Fly   200 ILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGNTKG 264
            :|:||||.|||||||||:|||.||.:|||.:||:||:|.:.||||.||..||||||.||.|...|
 Frog   200 VLMKKSGCRTPRIELEEMGPSFDFVVRRTHLASDDLFKLSLKQPKALKAKKKKNISHDAFGTKFG 264

  Fly   265 RVHLGKQQTGSIQTRRVKALRKTPEEKKE 293
            |:|:.||....:|||::|.|:|.|.:..|
 Frog   265 RIHMQKQDLSKLQTRKMKGLKKRPSDTME 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 137/285 (48%)
rpf2NP_001008430.2 Brix 6..297 CDD:294606 138/290 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249577897
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 280 1.000 Inparanoid score I2708
OMA 1 1.010
OrthoDB 1 1.010 D434863at33208
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1060013
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.