DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and rpf2

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_999913.1 Gene:rpf2 ZFINID:ZDB-GENE-040426-2501 Length:308 Species:Danio rerio

Alignment Length:289 Identity:138/290 (48%)
Similarity:192/290 (66%) Gaps:6/290 (2%)


  Fly     6 IRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKNDITP 70
            |.|.|||:.|:.|.:||.:|.|:.:..:.:.|......|...:||:.|||||...:..:||.:.|
Zfish     7 IVKAKTRRSKRFLESRESKLKENPKNSMIIKGGNTSSTVSQALKDVYALKKPNAVLYKKKNMVRP 71

  Fly    71 FDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKNEKIG 135
            |:|.::|||.:.|:|.:||.|||.:||||:|:|.||:|:..|||||||||:.::::::.|.:|..
Zfish    72 FEDSTALEFFSKKSDCSLFLFGSHNKKRPNNLIFGRMFDFHVLDMFELGIENFRSLTDIKMDKCP 136

  Fly   136 ACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMRSYRI 200
            ...||.|||.|..:....|.:||:::..|.|...:|.::||.|:||||.||..:. .|.||||::
Zfish   137 EGTKPMLVFAGDLFETDREYQRLKSVLTDFFCGPRVSAVRLAGLEHVLHFTALEG-KIYMRSYKV 200

  Fly   201 LLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGNTKGR 265
            ||||||.|||||||||||||.||::||...||:||||.|.:|||..|..||||||.||.|...||
Zfish   201 LLKKSGCRTPRIELEEIGPSFDFTMRRNHTASDDLYKTAHRQPKGAKPKKKKNISHDAFGTRLGR 265

  Fly   266 VHLGKQQTGSIQTRRVKALRK-----TPE 289
            :|:.||....:|||::|.|||     ||:
Zfish   266 LHMQKQDLNKLQTRKMKGLRKRRAEHTPD 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 138/290 (48%)
rpf2NP_999913.1 Brix 8..286 CDD:294606 134/279 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249578934
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 265 1.000 Inparanoid score I2993
OMA 1 1.010
OrthoDB 1 1.010 D434863at33208
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1053235
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.