DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and Rpf2

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001099861.1 Gene:Rpf2 RGDID:1306906 Length:306 Species:Rattus norvegicus

Alignment Length:298 Identity:138/299 (46%)
Similarity:197/299 (66%) Gaps:1/299 (0%)


  Fly     2 SLLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKN 66
            :|.::.||||::.|:.|..|||:|.|:.:..:.:.|......|...::|:.|||||...:..:||
  Rat     3 ALDKVLKPKTKRAKRFLEKREPKLSENIKNAMLIKGGNANATVTQVLRDVYALKKPYGVLYKKKN 67

  Fly    67 DITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKN 131
            ...||:|.:||||.:.|:|.:||.|||.:||||:|:::||:::..||||.||||:::.::.:.|.
  Rat    68 ITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKT 132

  Fly   132 EKIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMR 196
            .|.....||.|:|.|..:..||:.|||:||.||.|:...|.::||.|:|:||.||..:. .:..|
  Rat   133 SKCPEGTKPMLIFAGDDFDVTEDYRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNG-KVYFR 196

  Fly   197 SYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGN 261
            ||::||||||.|||||||||:|||.|..:|||.:||:||||.:.|.||.||..|:||||.|..|.
  Rat   197 SYKLLLKKSGCRTPRIELEEMGPSLDLVVRRTHLASDDLYKLSMKVPKALKPKKRKNISQDTFGT 261

  Fly   262 TKGRVHLGKQQTGSIQTRRVKALRKTPEEKKENRQRKK 299
            |.||:|:.||....:|||:||.|:|.|.|.....|.||
  Rat   262 TFGRIHMQKQDLSKLQTRKVKGLKKRPAENGVEDQGKK 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 134/287 (47%)
Rpf2NP_001099861.1 Brix 6..286 CDD:294606 131/281 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249574742
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 274 1.000 Inparanoid score I2845
OMA 1 1.010
OrthoDB 1 1.010 D434863at33208
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1087585
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.