DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and SPAC926.08c

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_594369.1 Gene:SPAC926.08c PomBaseID:SPAC926.08c Length:317 Species:Schizosaccharomyces pombe

Alignment Length:304 Identity:113/305 (37%)
Similarity:174/305 (57%) Gaps:8/305 (3%)


  Fly     3 LLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKND 67
            :||..|||..:.|:.|..|||:|:|.|:|.:||.|..........:.|:.|||||......:||:
pombe     1 MLRQVKPKNARTKRALEKREPKLVEGAKTAIFLRGNATSQISLDVLGDIHALKKPFSVNFQKKNN 65

  Fly    68 ITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKNE 132
            |.||:|.|||||.:.||||||....:.:||||.|:...|.|...||||.||||..|::|..|...
pombe    66 ILPFEDASSLEFFSEKNDAALAVMATHNKKRPHNLTWVRFFNYRVLDMIELGIVNYKSIQSFSAT 130

  Fly   133 KIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMN----- 192
            .|....||.::|.||.:......|.:::||:|.|:.|.:..:...|:.:|:..:..:...     
pombe   131 PIVPGTKPMILFQGPVFDAHPTYRHIKSLFLDFFRGEPIQKLDSAGLSYVIVVSAAEAQEDETKP 195

  Fly   193 ---ILMRSYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNI 254
               :..|.|...|.|:....||:||||:||..||:|||.:.|..|:.::|.|:||..:...|||:
pombe   196 LPLVHFRVYGTKLLKTKTNLPRVELEEMGPRIDFNIRRVQPAESDVLEEALKKPKTQEPKPKKNV 260

  Fly   255 STDALGNTKGRVHLGKQQTGSIQTRRVKALRKTPEEKKENRQRK 298
            ..|.:||..||:|:.:|..|::|||::|.|:::.||::::...:
pombe   261 DVDIIGNKVGRIHVDQQDLGNLQTRKMKGLKRSVEEREDSENEE 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 112/295 (38%)
SPAC926.08cNP_594369.1 RPF2 1..317 CDD:227437 113/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 212 1.000 Inparanoid score I931
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T1125189
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.