DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Non3 and Y54E10A.10

Sequence 1:NP_650694.2 Gene:Non3 FlyBaseID:FBgn0038585 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_491117.1 Gene:Y54E10A.10 WormBaseID:WBGene00021830 Length:297 Species:Caenorhabditis elegans

Alignment Length:294 Identity:123/295 (42%)
Similarity:184/295 (62%) Gaps:2/295 (1%)


  Fly     3 LLRIRKPKTRKGKKVLLAREPQLIESARTMLFLDGRKCGGNVKLCMKDLQALKKPLVKVLNRKND 67
            ::|:.|.||:|||:||:.|..:.:|:.:..||..|.|....:...|.||..:||||...:::.|.
 Worm     1 MVRVEKIKTKKGKRVLVNRASKTVENDKKALFCRGAKTNEIISHAMMDLFDMKKPLTTKMDKHNP 65

  Fly    68 ITPFDDPSSLEFLTMKNDAALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKNE 132
            ...|:|.:.:.....|.|.:||..||.|||:|:.:..||.::.::|||.||.|..|::.|.|:..
 Worm    66 YHLFEDETPIVRAGSKFDTSLFVLGSNSKKKPNCLTFGRTYDGQLLDMAELRITSYKSSSNFEAA 130

  Fly   133 KIGACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSFTVTDDMNILMRS 197
            |:....|||::..|..:....:::|:.||.:|.|:..|||::||:|:|.|:.||..|:.|:.:|.
 Worm   131 KMTLGSKPCVILEGAAFESDGDMKRIGNLMVDWFRGPKVDTVRLEGLETVIVFTALDETNLALRV 195

  Fly   198 YRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDLYKQARKQPKQLKVGKKKNISTDALGNT 262
            ||.:||||...|||:||.|:|||..|.:.|.|:|.:.|:|.|.|:||.|...::||:|.|..||.
 Worm   196 YRPMLKKSATATPRVELAEMGPSISFEVMRKKLADDALFKLACKKPKALMKKRRKNLSEDVFGNQ 260

  Fly   263 KGRVHLGKQQTGSIQTRRVKALRKTP--EEKKEN 294
            ..|||:|||:|..||||:||||||||  |...||
 Worm   261 LARVHVGKQRTDDIQTRKVKALRKTPLVEAAPEN 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Non3NP_650694.2 Brix 3..290 CDD:294606 121/289 (42%)
Y54E10A.10NP_491117.1 Brix 1..284 CDD:294606 117/283 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249573392
eggNOG 1 0.900 E1_COG5106
Hieranoid 1 1.000
Homologene 1 1.000 H6404
Inparanoid 1 1.050 237 1.000 Inparanoid score I2102
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D434863at33208
OrthoFinder 1 1.000 FOG0004191
OrthoInspector 1 1.000 T474270
orthoMCL 1 0.900 OOG5_127909
Panther 1 1.100 LDO PTHR12728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1197
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.