DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7183 and Ccdc174

DIOPT Version :8

Sequence 1:NP_001262701.1 Gene:CG7183 / 42181 FlyBaseID:FBgn0038583 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_766318.2 Gene:Ccdc174 / 232236 MGIID:2444652 Length:467 Species:Mus musculus

Alignment Length:540 Identity:144/541 (27%)
Similarity:230/541 (43%) Gaps:125/541 (23%)


  Fly     1 MNDPNKAISVNLSSLLSLKAELLRKQHEVRVAKATKASAADFRPTKSAGNKEKS----SDQGYKK 61
            |:...|.:.|..|||:.|||||.|||.|.:..|..|.|....:|  ...||:.|    .:.|...
Mouse     1 MDRKKKPLDVTASSLVDLKAELFRKQEEFKQEKLLKDSGVFGKP--KTINKKPSIWSKQNAGVTS 63

  Fly    62 VASSDDGAKVYEAEDHAQLEKSRRILEAKSKFYDRMSRNGGSLNS--DDNCLVMFNRKKQEADRE 124
            .|..|...|:   |:...|:|:|..||.|:|.|::|:: |..|:.  :|..||.|.:|..:..:|
Mouse    64 RAEKDAEQKL---EEQKTLDKAREKLEEKAKLYEKMTK-GDFLDEEVEDMYLVDFTQKIIDKRKE 124

  Fly   125 PEQCTQRRESRQRLSSSSSSSQDEEGHDDLE-----------------VEYVDCLGRTRKCLRKD 172
            .|.....|||:         .::|...||.|                 |:|||.|||:|:|:|||
Mouse   125 MEVLGATRESQ---------IEEERDDDDKEEFSDKDIPPPQDPSEEWVDYVDSLGRSRRCMRKD 180

  Fly   173 LKEAKRRDKQLAESMPERLDQTKANWMINTKGSRELNSNHNSDDESFIGPRPTESVFSEALSTMT 237
            |......||.|...:                               |:.|...:::.||.:    
Mouse   181 LPSLLEMDKNLQGRL-------------------------------FVSPANEKTLLSEDM---- 210

  Fly   238 KHDEQRMNWERKEQENFEKP--DVHYQDVFFDEARTHGVGYYAFSTDEDERRQQQLDLEKARQAT 300
            :.:.||..||.:|:|..:||  .:||:|:..:|||..||||:||:.|::.|.:|...||..|:.|
Mouse   211 RKELQRQQWEEEEREALKKPMGPIHYEDIRENEARQLGVGYFAFARDKELRNKQMKTLEMLREQT 275

  Fly   301 KAKQMRRDELRAQRDRLVADRVLAAKNRIRERNGLPPISEEDYLREEQQKKDELAKEEAELNRAE 365
            ..::::|:.::.:|..::..|:...:.:..::      |:||...||.::.|.:..|.:|.....
Mouse   276 TDQRIKRENIKEKRKAMLEARLAKLRQKKMKK------SKEDGTEEEGREADGVVPEPSEPKPVP 334

  Fly   366 QERRAAIERKKEKEEAELEELRK-----EHVRDWDKNKPGVRKLADSESAEPPEEEWKYKAERLP 425
            .....|   :..|.|..::|.|.     .|:|:||:.|                          .
Mouse   335 APAPVA---QNSKVEVIIQERRDTKPGVPHIREWDRGK--------------------------D 370

  Fly   426 MSQEEWNEKQ---RAQRHAEFAPMPEP--VPLKRSNFSSMPPPMVWNRAQEPQFHNFHSTKEEKK 485
            .|...|::||   ||:|..|||| |..  |..||:...|..|......|.....|:...::|...
Mouse   371 FSFGFWSKKQSELRAERDPEFAP-PSNYFVGQKRTAPMSSQPQSRPGSAPSDLGHSSGQSQEPSS 434

  Fly   486 FQRRSYSANNEDEADEQPST 505
                |:::....|:..|..|
Mouse   435 ----SHTSTPASESSPQAPT 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7183NP_001262701.1 DUF4078 248..328 CDD:290039 26/82 (32%)
Ccdc174NP_766318.2 DUF4078 230..303 CDD:290039 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213929592
eggNOG 1 0.900 E1_28PWN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004873
OrthoInspector 1 1.000 T1084032
orthoMCL 1 0.900 OOG5_130708
Panther 1 1.100 LDO PTHR15885
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5389
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.