DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7785 and spryd7

DIOPT Version :8

Sequence 1:NP_650673.1 Gene:CG7785 / 42158 FlyBaseID:FBgn0038564 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001016934.1 Gene:spryd7 / 549688 XenbaseID:XB-GENE-1003353 Length:195 Species:Xenopus tropicalis

Alignment Length:254 Identity:88/255 (35%)
Similarity:121/255 (47%) Gaps:66/255 (26%)


  Fly     3 CCLRTCLNGGHIRKPTATSRLRE-PDVHLDAAHMGPDVILLSHQLRVTGTGGVLATAPLVQSKSY 66
            ||.|.|::.|     |....|:| |.|.||..|||.||:::.:..|:.|||..||.|||.|:|||
 Frog     6 CCFRCCMDDG-----TGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGACLANAPLHQNKSY 65

  Fly    67 FEVKIQHGGSWSVGLATRQTDLSRKSGGGDRESWCLCSDNATRHNDREEFRPVVQSACTTQPART 131
            ||.|:|..|.|.:|:||::.:|::...|.|..|..:.:|.|..:|:.|:.|              
 Frog    66 FEFKVQSTGIWGIGVATQKANLNQIPLGRDVHSLVMRNDGAIYYNNEEKNR-------------- 116

  Fly   132 SNGILNNSAAKAAGLIAIEDLQQEDLLMTTGVASSDVDIGDSLIASPQRDFPDEGDIVGVAFDHV 196
                                                         .|....|.|||:||:.:|||
 Frog   117 ---------------------------------------------LPANSLPQEGDVVGITYDHV 136

  Fly   197 ELNFYFNGKNLEVPFRNVRGAALFPVIYVGNGAILDIILDNFSHGPPPGFERILLEQSL 255
            |||.|.||||:..|...:|| .::||:||.:.||||.....|.|.||.|||:||.||.:
 Frog   137 ELNIYLNGKNMHCPASGIRG-TVYPVVYVDDSAILDCQFSEFYHTPPAGFEKILFEQQI 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7785NP_650673.1 SPRYD7 35..256 CDD:293938 75/222 (34%)
spryd7NP_001016934.1 SPRYD7 34..195 CDD:293938 75/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255202182
eggNOG 1 0.900 E1_KOG4030
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10725
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1278394at2759
OrthoFinder 1 1.000 FOG0004939
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.