DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and ALG1

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_009668.3 Gene:ALG1 SGDID:S000000314 Length:449 Species:Saccharomyces cerevisiae

Alignment Length:440 Identity:159/441 (36%)
Similarity:233/441 (53%) Gaps:52/441 (12%)


  Fly     8 KRNACVIVLGDIGRSPRMQYHAQSLLEENYHVDMIGYLETRPLEELTQHPRCRIHELTAVPVTNL 72
            |:...:.||||:|.|||:.|||.|..:..:.|::.||:|....:.::..|...:|.:     :||
Yeast    38 KKRIIIFVLGDVGHSPRICYHAISFSKLGWQVELCGYVEDTLPKIISSDPNITVHHM-----SNL 97

  Fly    73 ------TPKLRLLFKAFWQTLSLLMALISIGRPSFLLVQNPPGIPTLIVCYLYCAVTRTKLAIDW 131
                  |..:.::.|..:|.||:...|..:....::||||||.||.|.:..|| .:|..||.|||
Yeast    98 KRKGGGTSVIFMVKKVLFQVLSIFKLLWELRGSDYILVQNPPSIPILPIAVLY-KLTGCKLIIDW 161

  Fly   132 HNYTYTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVK--VLYD 194
            ||..|::|.|........||:.:...:|..|...|..:..||.||::.|.|::.:.|.:  ||||
Yeast   162 HNLAYSILQLKFKGNFYHPLVLISYMVEMIFSKFADYNLTVTEAMRKYLIQSFHLNPKRCAVLYD 226

  Fly   195 RAPAQFHPI--DLTHKHELYLK-LAKDY--PQFQAKDAEQSDVLEATALTQKLASGVVQYRPQRQ 254
            |..:||.|:  |::.:..|..| ..|:|  ..|   |.|:.|                       
Yeast   227 RPASQFQPLAGDISRQKALTTKAFIKNYIRDDF---DTEKGD----------------------- 265

  Fly   255 AVLVSSTSWTPDEDFGILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEHYVAEIEKLQWQKV 319
            .::|:|||:|||||.||||.||:.||.:........|.:||.||||||.||.|:.::|:..|::.
Yeast   266 KIIVTSTSFTPDEDIGILLGALKIYENSYVKFDSSLPKILCFITGKGPLKEKYMKQVEEYDWKRC 330

  Fly   320 SVITPWLEIEDYPTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGLPVCAYDFKCLDELVKHGEN 384
            .:...||..||||.:|...|.||.||.|:||||||||::|||||||||.|.::..|||||:|..|
Yeast   331 QIEFVWLSAEDYPKLLQLCDYGVSLHTSSSGLDLPMKILDMFGSGLPVIAMNYPVLDELVQHNVN 395

  Fly   385 GFVFGDHVQLAEQLRIWFENFPKNPSILETRAGFQRKIQEFQELRWRESW 434
            |..|.|..:|.|.|     .|....:.|..:  .::.:.:..|.||:.:|
Yeast   396 GLKFVDRRELHESL-----IFAMKDADLYQK--LKKNVTQEAENRWQSNW 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 159/441 (36%)
PLN02275 7..402 CDD:215155 153/407 (38%)
ALG1NP_009668.3 GT1_ALG1_like 36..445 CDD:99986 159/441 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355648041
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H5387
Inparanoid 1 1.050 254 1.000 Inparanoid score I643
Isobase 1 0.950 0 Normalized mean entropy S1491
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003457
OrthoInspector 1 1.000 T1136310
orthoMCL 1 0.900 OOG5_128548
Panther 1 1.100 LDO PTHR13036
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R40
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.