DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and GSY2

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_013359.1 Gene:GSY2 / 850962 SGDID:S000004248 Length:705 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:43/208 - (20%)
Similarity:67/208 - (32%) Gaps:65/208 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 TALTQKLASGVVQYR-------PQRQAVL---VSSTSWTPDEDFGILLKALQAYEETAQAEPL-- 288
            :.|..|....|.||:       |..:|..   |....|...|.|...::.:|...:|.::..:  
Yeast    26 SVLKSKAPITVAQYKDHYHLIGPLNKATYQNEVDILDWKKPEAFSDEMRPVQHALQTMESRGVHF 90

  Fly   289 VYPSLLCIITGKGPQK---------EHYVAEIEKLQWQKVSVITPWLEIEDYPTVLASADLGVCL 344
            ||...|.    :|..|         ..|..|.:...|..|.:.:|..:.|....:|    ||..:
Yeast    91 VYGRWLI----EGAPKVILFDLDSVRGYSNEWKGDLWSLVGIPSPENDFETNDAIL----LGYTV 147

  Fly   345 HW---STSGLDLPMKVVDMF-----GSGLPVC--------------------------AYDF-KC 374
            .|   ..:.||....:|..|     |..||:|                          ::|| .|
Yeast   148 AWFLGEVAHLDSQHAIVAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGSFDFYNC 212

  Fly   375 LDEL-VKHGENGF 386
            |:.: |.|....|
Yeast   213 LESVDVDHEAGRF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 43/208 (21%)
PLN02275 7..402 CDD:215155 43/208 (21%)
GSY2NP_013359.1 GT3_GSY2-like 7..616 CDD:340824 43/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.