DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and GSY2

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_013359.1 Gene:GSY2 SGDID:S000004248 Length:705 Species:Saccharomyces cerevisiae

Alignment Length:208 Identity:43/209 (21%)
Similarity:67/209 (32%) Gaps:65/209 (31%)


  Fly   236 TALTQKLASGVVQYR-------PQRQAVL---VSSTSWTPDEDFGILLKALQAYEETAQAEPL-- 288
            :.|..|....|.||:       |..:|..   |....|...|.|...::.:|...:|.::..:  
Yeast    26 SVLKSKAPITVAQYKDHYHLIGPLNKATYQNEVDILDWKKPEAFSDEMRPVQHALQTMESRGVHF 90

  Fly   289 VYPSLLCIITGKGPQK---------EHYVAEIEKLQWQKVSVITPWLEIEDYPTVLASADLGVCL 344
            ||...|.    :|..|         ..|..|.:...|..|.:.:|..:.|....:|    ||..:
Yeast    91 VYGRWLI----EGAPKVILFDLDSVRGYSNEWKGDLWSLVGIPSPENDFETNDAIL----LGYTV 147

  Fly   345 HW---STSGLDLPMKVVDMF-----GSGLPVC--------------------------AYDF-KC 374
            .|   ..:.||....:|..|     |..||:|                          ::|| .|
Yeast   148 AWFLGEVAHLDSQHAIVAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGSFDFYNC 212

  Fly   375 LDEL-VKHGENGF 386
            |:.: |.|....|
Yeast   213 LESVDVDHEAGRF 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 43/209 (21%)
PLN02275 7..402 CDD:215155 43/209 (21%)
GSY2NP_013359.1 GT1_Glycogen_synthase_GSY2_like 7..616 CDD:99967 43/209 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.