| Sequence 1: | NP_650662.1 | Gene: | Alg1 / 42146 | FlyBaseID: | FBgn0038552 | Length: | 446 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001119918.1 | Gene: | piga / 791759 | ZFINID: | ZDB-GENE-040426-1086 | Length: | 487 | Species: | Danio rerio | 
| Alignment Length: | 432 | Identity: | 85/432 - (19%) | 
|---|---|---|---|
| Similarity: | 136/432 - (31%) | Gaps: | 161/432 - (37%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    95 SIGRPSFLLVQNPPGIPTLIVCYLYCAVTR-TKLAIDWHNYTYTVLALGMSKGEQSPLIRLVRRL 158 
  Fly   159 ERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQ--FHP------------IDLTHKH 209 
  Fly   210 ELYLKLAKDYPQFQAKD---------------AEQSDVLEATALTQKLASG----VVQYRPQRQA 255 
  Fly   256 VL---------------VSSTSWTPD------EDFGILLKALQAYEETAQAEPLVYPSL------ 293 
  Fly   294 LC-IITGKGPQKEHYVAEI-EKLQWQKVSVITPWLEIEDYPTVLASADL--------GVCL---H 345 
  Fly   346 WSTSGLD------------LPMKVVDMFGSGLPVCAYDFKC--LDELVKHGENGFVFGDHVQLAE 396 
  Fly   397 QLRIWFENFPKNPSILETRAGFQRKIQEFQELRWRESWRLIA 438 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Alg1 | NP_650662.1 | GT1_ALG1_like | 6..442 | CDD:99986 | 85/432 (20%) | 
| PLN02275 | 7..402 | CDD:215155 | 77/394 (20%) | ||
| piga | NP_001119918.1 | GT1_PIG-A_like | 38..437 | CDD:99970 | 85/432 (20%) | 
| RfaB | 39..409 | CDD:223515 | 84/431 (19%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0438 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||