DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and piga

DIOPT Version :8

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001119918.1 Gene:piga / 791759 ZFINID:ZDB-GENE-040426-1086 Length:487 Species:Danio rerio

Alignment Length:432 Identity:85/433 (20%)
Similarity:136/433 (31%) Gaps:161/433 (37%)


  Fly    95 SIGRPSFLLVQNPPGIPTLIVCYLYCAVTR-TKLAIDWHNYTYTVLALGMSKGEQSPLIRLVRRL 158
            ||...|.....|..|:.:.|.....|.:.: .|:.|..|.|           |::..:..|...|
Zfish    38 SICMVSDFFYPNMGGVESHIYQLSQCLIEKGHKVVIATHAY-----------GDRRGIRYLTNGL 91

  Fly   159 ERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQ--FHP------------IDLTHKH 209
            :.|:                        .|::|:|:::.:.  ||.            |.:.|.|
Zfish    92 KVYY------------------------LPLQVMYNQSTSTTCFHSLPLLRCIFVRECITIVHAH 132

  Fly   210 ELYLKLAKDYPQFQAKD---------------AEQSDVLEATALTQKLASG----VVQYRPQRQA 255
            ..:..:|.| ..|.||.               |:.|.||....||..|...    .|.|..:...
Zfish   133 SSFSAMAHD-ALFHAKTMGLNTVFTDHSLFGFADLSSVLTNKLLTVSLCDTNHIVCVSYTSKENT 196

  Fly   256 VL---------------VSSTSWTPD------EDFGILLKALQAYEETAQAEPLVYPSL------ 293
            ||               |..|.:|||      ....|::.:...|.:.......:.|.|      
Zfish   197 VLRATLDPEIVSVIPNAVDPTDFTPDPCRRDNSKITIVVISRLVYRKGIDLLSGIIPELCGRHPD 261

  Fly   294 LC-IITGKGPQKEHYVAEI-EKLQWQKVSVITPWLEIEDYPTVLASADL--------GVCL---H 345
            || :|.|:|| |...:.|: ||.|......:...|:.:|...||....:        ..|:   .
Zfish   262 LCFLIGGEGP-KRIILEEVREKYQLHDRVRLLGALDHKDVRDVLVQGHIFLNTSLTEAFCMAIVE 325

  Fly   346 WSTSGLD------------LPMKVVDMFGSGLPVCAYDFKC--LDELVKHGENGFVFGDHVQLAE 396
            .::.||.            ||.::|.:.|..  ||:.   |  |:.::|...:|.|         
Zfish   326 GASCGLQVVSTRVGGIPEVLPNELVTLCGPS--VCSL---CDGLETVIKKIRSGNV--------- 376

  Fly   397 QLRIWFENFPKNPSILETRAGFQRKIQEFQELRWRESWRLIA 438
                            |:.|...||:      |...:||.:|
Zfish   377 ----------------ESPAAIHRKV------RTLYTWRNVA 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 85/433 (20%)
PLN02275 7..402 CDD:215155 77/395 (19%)
pigaNP_001119918.1 GT1_PIG-A_like 38..437 CDD:99970 85/433 (20%)
RfaB 39..409 CDD:223515 84/432 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.