DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and alg1

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_012825942.1 Gene:alg1 XenbaseID:XB-GENE-1006362 Length:485 Species:Xenopus tropicalis

Alignment Length:444 Identity:202/445 (45%)
Similarity:283/445 (64%) Gaps:18/445 (4%)


  Fly     6 PK-KRNACVIVLGDIGRSPRMQYHAQSLLEENYHVDMIGYLETRPLEELTQHPRCRIHELTAVPV 69
            || .:..||:|||||||||||.|||.||....:.|.:.|:.||.|..:|..|.|..|..::...:
 Frog    47 PKGNKRICVLVLGDIGRSPRMTYHALSLARHGFFVTLTGFRETEPHRDLLHHERINIQPVSEFRM 111

  Fly    70 TNLTPKL-RLLFKAFWQTLSLLMALISIGRPSFLLVQNPPGIPTLIVCYLYCAVTRTKLAIDWHN 133
            ..:.|:: :...|...|...|...|:.|...|::::|||||:|::.|.:|:|.:.|::|.|||||
 Frog   112 LKVGPRMFQYFIKVIVQAFQLFYILLKIDPLSYIILQNPPGLPSIAVTWLFCVLRRSQLIIDWHN 176

  Fly   134 YTYTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPA 198
            |.|::::|  :.|.:.|::|:.:..|:.||..:..:||||.||:|||..||.| ....|||:..:
 Frog   177 YGYSIMSL--TNGPKHPIVRIAKWYEKVFGRLSDYNFCVTNAMKEDLMVNWNI-KAATLYDKPAS 238

  Fly   199 QFHPIDLTHKHELYLKLAKDYPQFQAKDAEQSDVLEATALTQ-KLASGVVQYRPQRQAVLVSSTS 262
            .|....:..:|:|::||||:||.|:.....:....|.||.|: ||..|.:.:..:..|:|:||||
 Frog   239 IFQETPIEMQHKLFMKLAKEYPPFKYPSQSKCSGTEKTAFTELKLEKGTISFNKECPALLISSTS 303

  Fly   263 WTPDEDFGILLKALQAYE----ETAQAEPLVYPSLLCIITGKGPQKEHYVAEIEKLQWQKVSVIT 323
            ||.||||.||||||:.||    ..|:..|||     |:||||||.||||...|.::|::.:.:.|
 Frog   304 WTEDEDFSILLKALEEYELFIRNGAKLPPLV-----CVITGKGPLKEHYSKLIREMQFKNIQICT 363

  Fly   324 PWLEIEDYPTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGLPVCAYDFKCLDELVKHGENGFVF 388
            ||||.||||.:|.||:||||||.|:||||||||||||||..|||||.:||||.|||||||||.:|
 Frog   364 PWLEAEDYPLLLGSANLGVCLHKSSSGLDLPMKVVDMFGCCLPVCAINFKCLQELVKHGENGLIF 428

  Fly   389 GDHVQLAEQLRIWFENFPKNPSILETRAGFQRKIQEFQELRWRESWRLIAAPVL 442
            .|.::|||||:..|.:|....|.|:.   ||:.::|..:.||.|:|..|..||:
 Frog   429 KDSLELAEQLKDMFTDFTSKSSKLKR---FQQNLRESVQTRWDETWDQIVLPVI 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 202/443 (46%)
PLN02275 7..402 CDD:215155 187/402 (47%)
alg1XP_012825942.1 GT1_ALG1_like 51..479 CDD:99986 200/439 (46%)
PLN02275 51..442 CDD:215155 186/399 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355637063
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5387
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D330469at33208
OrthoFinder 1 1.000 FOG0003457
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R40
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.