DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and Piga

DIOPT Version :8

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_006256932.1 Gene:Piga / 363464 RGDID:1589723 Length:485 Species:Rattus norvegicus

Alignment Length:314 Identity:69/315 (22%)
Similarity:103/315 (33%) Gaps:115/315 (37%)


  Fly   188 PVKVLYDRAPAQ--FHP------------IDLTHKHELYLKLAKDYPQFQAKD------------ 226
            |::|:|:::.|.  ||.            |.:.|.|..:..:|.| ..|.||.            
  Rat    93 PLRVMYNQSTATTLFHSLPLLRYIFVRERITIIHSHSSFSAMAHD-ALFHAKTMGLQTVFTDHSL 156

  Fly   227 ---AEQSDVLEATALTQKLASG----VVQYRPQRQAVL---------------VSSTSWTPDEDF 269
               |:.|.||....||..|...    .|.|..:...||               |..|.:|| |.|
  Rat   157 FGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTP-EPF 220

  Fly   270 -------------------------GILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEHYVA 309
                                     ||:.:..|.|:|           |..:|.|:|| |...:.
  Rat   221 RRHDSVITVVVVSRLVYRKGTDLLSGIIPELCQKYQE-----------LNFLIGGEGP-KRIILE 273

  Fly   310 EI-EKLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLD-LPMKVVDMFGSGLPVCAYDF 372
            |: |:.|......:...||.:|...||....:.:    :||..: ..|.:|:....||.|.:...
  Rat   274 EVRERYQLHDRVQLLGALEHKDVRNVLVQGHIFL----NTSLTEAFCMAIVEAASCGLQVVSTKV 334

  Fly   373 KCLDELVKHGENGFVFGDHVQLAEQLRIWFENFPKNPSILETRAGFQRKIQEFQ 426
            ..:.|:               |.|.|.|..|     ||:.....|.::.|  ||
  Rat   335 GGIPEV---------------LPENLIILCE-----PSVKSLCEGLEKAI--FQ 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 69/315 (22%)
PLN02275 7..402 CDD:215155 62/289 (21%)
PigaXP_006256932.1 GT1_PIG-A_like 34..433 CDD:99970 69/315 (22%)
RfaB 34..406 CDD:223515 69/315 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.