DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and Alg1

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_663337.2 Gene:Alg1 MGIID:2384774 Length:482 Species:Mus musculus

Alignment Length:442 Identity:207/443 (47%)
Similarity:288/443 (65%) Gaps:17/443 (4%)


  Fly     7 KKRNACVIVLGDIGRSPRMQYHAQSLLEENYHVDMIGYLETRPLEELTQHPRCRIHELTAVPVTN 71
            :.|:..|:||||:||||||||||.||.:..:.|.::|:..::|.:||.|:.|.||.:||.:....
Mouse    31 RARHMVVVVLGDVGRSPRMQYHALSLAQSGFSVTLLGFYNSKPRDELLQNDRIRIVKLTDLRGLG 95

  Fly    72 LTPK-LRLLFKAFWQTLSLLMALISIGRPSFLLVQNPPGIPTLIVCYLYCAVTRTKLAIDWHNYT 135
            ..|: |:...|..:|.:.||..::.:...:::.:|||||:|.:.||:....:..:||.||||||.
Mouse    96 AGPRILQYGVKVVFQAVYLLWKMMRMDPAAYIFLQNPPGLPAIAVCWFVGCICGSKLVIDWHNYG 160

  Fly   136 YTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQF 200
            |::  :|:..|.:.|::.|.:..|::||..:|.:.|||.||:|||.:||.:..| .|||: ||.|
Mouse   161 YSI--MGLVHGPRHPIVLLAKWYEKFFGRLSHLNLCVTNAMREDLAENWCVRAV-TLYDK-PASF 221

  Fly   201 H---PIDLTHKHELYLKLAKDYPQFQA-KDAEQSDVLEATALTQK-LASGVVQYRPQRQAVLVSS 260
            .   |:||  :|||::||:..|..||: .|....|. |.:|.|:: ..||||:....|.|:||||
Mouse   222 FKETPLDL--QHELFMKLSHTYSPFQSCSDPSHPDT-ERSAFTERDCQSGVVRRLHGRPALLVSS 283

  Fly   261 TSWTPDEDFGILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEHYVAEIEKLQWQKVSVITPW 325
            ||||.||||.|||:||:.:|:.|.....: |||:|:||||||.:|||...|.:...|.|...|||
Mouse   284 TSWTEDEDFSILLRALEKFEQQALTGDSL-PSLVCVITGKGPLREHYRHLISQKHLQHVRFCTPW 347

  Fly   326 LEIEDYPTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGLPVCAYDFKCLDELVKHGENGFVFGD 390
            ||.||||.:|.|||||||||.|:||||||||||||||..|||||.:||||.|||:|||||.||.|
Mouse   348 LEAEDYPLLLGSADLGVCLHMSSSGLDLPMKVVDMFGCHLPVCAVNFKCLHELVRHGENGLVFKD 412

  Fly   391 HVQLAEQLRIWFENFPKNPSILETRAGFQRKIQEFQELRWRESWRLIAAPVL 442
            ..:||.||::.|..||.....|   :.|::|:||..:.||.|||:....|:|
Mouse   413 AEELAAQLQMLFSKFPDPAGKL---SQFRKKLQESGQQRWDESWQHTVLPLL 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 206/441 (47%)
PLN02275 7..402 CDD:215155 192/401 (48%)
Alg1NP_663337.2 PLN02275 29..424 CDD:215155 192/399 (48%)
GT1_ALG1_like 33..461 CDD:99986 205/434 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355638639
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H5387
Inparanoid 1 1.050 381 1.000 Inparanoid score I2035
Isobase 1 0.950 0 Normalized mean entropy S1491
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003457
OrthoInspector 1 1.000 T1084042
orthoMCL 1 0.900 OOG5_128548
Panther 1 1.100 LDO PTHR13036
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R40
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.