DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and Alg11

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001230090.1 Gene:Alg11 MGIID:2142632 Length:492 Species:Mus musculus

Alignment Length:159 Identity:33/160 (21%)
Similarity:53/160 (33%) Gaps:26/160 (16%)


  Fly   111 PTLIVCYLYCAVTRTKL-AIDWHNYTYTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTR 174
            |.|::|.:.|......| .|.||.............|::..::..........|......:|..|
Mouse    23 PGLMICGVLCVYLVIGLWVIRWHLQRKKKSVSTSKNGKEQTVVAFFHPYCNAGGGGERVLWCALR 87

  Fly   175 AMQEDLQQNWGI---GPVKV----LYDRAPAQF-----HPIDLTHKHELYLKLAKDYPQFQAKDA 227
            |:|:...:...:   |.:.|    :.|.|..:|     ||:......:.||.....||.|     
Mouse    88 ALQKKYPEAVYVVYTGDINVSGQQILDGAFRRFNIKLAHPVQFVFLRKRYLVEDSRYPHF----- 147

  Fly   228 EQSDVLEATALTQKLASGVVQYRPQRQAV 256
                    |.|.|.|.|.::.:....|.|
Mouse   148 --------TLLGQSLGSILLGWEALMQRV 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 33/160 (21%)
PLN02275 7..402 CDD:215155 33/160 (21%)
Alg11NP_001230090.1 PLN02949 64..492 CDD:215511 24/119 (20%)
GT1_ALG11_like 64..480 CDD:99978 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.