DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and algn-11

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_498606.1 Gene:algn-11 WormBaseID:WBGene00015162 Length:470 Species:Caenorhabditis elegans

Alignment Length:423 Identity:83/424 (20%)
Similarity:147/424 (35%) Gaps:103/424 (24%)


  Fly    44 YLETRPLEELTQHPRC-RIHELTAVPVTNLTPKLRLLFKAFWQTLSLLMALISIGRPSFLLVQNP 107
            ||..|.|.|...:..| .:.:..|..:..|....|::...|..::...::|     |:|.|..:.
 Worm   111 YLHWRTLVEARHYKHCTMLFQALAGLILALEAWFRMVPAVFIDSMGYPLSL-----PAFRLSGSK 170

  Fly   108 PGIPTLIVCYL-YCAVTRTKLAI-----DWHNYTYTVLALGMSKGEQSPLIRLVRRLERYFGSKA 166
                  :|.|: |..::...|.:     :..|.:.|:....:....:....||...|....|..|
 Worm   171 ------VVAYVHYPTISCDMLDVVESRQETFNNSSTIAQSNVLSWGKLTYYRLFACLYWLAGKAA 229

  Fly   167 HTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQFHPIDLTHKHELYLKLAKDYPQFQAKDAEQSD 231
            |.........|..:...|....|.::|.       |.|:    |.:|.:          ::....
 Worm   230 HVGMVNGSWTQRHITSIWSRRDVSIVYP-------PCDV----EAFLNI----------ESVAES 273

  Fly   232 VLEATALTQKLASGVVQYRPQRQAVLVSSTSWTPDEDFGILLKALQAYEETAQAEPLVYPSLLCI 296
            :||.|...:.|:.|.::                |:::..:.|:.|...:|  ..|.:.|...|||
 Worm   274 LLEDTKTVRLLSVGQIR----------------PEKNHKLQLEVLHDVKE--PLEKMGYNVELCI 320

  Fly   297 ITG-KGPQKEHYVA----EIEKLQ------WQKVSVITPWLEIEDYPTVLASADLGV-CLHWSTS 349
            ..| :..:.:..|.    |.|||.      ||   :..|:   ||....|:.|.:.: .:|....
 Worm   321 AGGCRNEEDQERVKMLKNEAEKLDISEQLIWQ---LNVPY---EDLVVELSKALISIHTMHNEHF 379

  Fly   350 GLDLPMKVVDMFG---------SGLP----VCAYDFKCLDELVKHGENGFVFGDHVQLAEQLRIW 401
            |:    .||:...         ||.|    |..|:..|:..|....|      ::|:..  |:|.
 Worm   380 GI----SVVEAMAASTIILSNDSGGPRMDIVKDYEGHCVGYLSITKE------EYVETI--LKIV 432

  Fly   402 FENFPKNPSILETRAGFQRKIQEFQELRWRESW 434
            .|...|..   :||...::.:..|.|..:...|
 Worm   433 EEGLKKRN---DTRKYARKSLTRFGEAAFETHW 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 83/424 (20%)
PLN02275 7..402 CDD:215155 76/390 (19%)
algn-11NP_498606.1 PLN02949 8..458 CDD:215511 82/418 (20%)
GT1_ALG11_like 41..461 CDD:99978 82/421 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.