DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and algn-1

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_498420.2 Gene:algn-1 WormBaseID:WBGene00020820 Length:491 Species:Caenorhabditis elegans

Alignment Length:447 Identity:186/448 (42%)
Similarity:262/448 (58%) Gaps:31/448 (7%)


  Fly     6 PKKRN-ACVIVLGDIGRSPRMQYHAQSLLEENYHVDMIGYLETRPLEELTQHPRCRIHELTAVP- 68
            |.:|: |.|:||||:||||||..||:.|.:|.:.|.:||:.::.|.|::..|||.:|..:...| 
 Worm     9 PDERSEAAVVVLGDVGRSPRMCNHAKMLADEGFDVKLIGFFDSIPGEQIMNHPRIKIVGIPPPPD 73

  Fly    69 -VTNLTPKLRLLFKAFWQTLSLLMAL---ISIGRPSFLLVQNPPGIPTLIVCYLYCAVTRTKLAI 129
             :.:|...::|..|.||..::|.:||   .|......:|:||||.:||:|||:::......|.:|
 Worm    74 FMDSLPAFVQLPLKLFWNFITLFLALAFQTSAFNLRIILMQNPPALPTMIVCFMFSIFKFAKFSI 138

  Fly   130 DWHNYTYTVL----------ALGM-SKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQN 183
            |||||.|::|          ..|. .|.:::.::|.|..||...|..:..:.|||.||:.||...
 Worm   139 DWHNYMYSILQNKYQLTDDQVFGNDKKTKKAQIVRCVGFLEGLCGKLSDYNLCVTNAMRRDLMDR 203

  Fly   184 WGIGPVKVLYDRAPA-QFHPIDLTHKHELYLKLAKDYPQFQAKDAEQSDVLEATALTQKLASGVV 247
            ||| .....|||.|. :|....:...|:|||:|::.....|.||.      ::|.||.|.::|||
 Worm   204 WGI-RASTFYDRPPTWKFRDTTIQEIHDLYLRLSQKERILQGKDE------DSTILTHKSSNGVV 261

  Fly   248 QYRPQRQAVLVSSTSWTPDEDFGILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEHYVAEIE 312
            |....|..|.:|||||||||.|.|||.||.||::|     :..|.:|.|||||||.|..|:.||.
 Worm   262 QLLTTRPIVFLSSTSWTPDERFEILLDALVAYDKT-----IGLPRVLMIITGKGPLKAKYLQEIH 321

  Fly   313 KLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGLPVCAYDFKCLDE 377
            :...:.|.|:|||||.||||.:|||||||:.||.||||||||||||||||:.:|..|..|||:||
 Worm   322 EKNLKNVDVLTPWLEAEDYPKILASADLGISLHTSTSGLDLPMKVVDMFGAKVPALALKFKCIDE 386

  Fly   378 LVKHGENGFVFGDHVQLAEQLRIWFENFPKN-PSILETRAGFQRKIQEFQELRWRES 433
            ||:...||::|.|..||:.|:......||.| ..::..:...|.:..:..|:.|:.|
 Worm   387 LVEEKTNGYLFDDSEQLSRQIIELSRGFPNNCNELIRLKKNTQEQKFDSWEVMWKRS 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 186/448 (42%)
PLN02275 7..402 CDD:215155 178/413 (43%)
algn-1NP_498420.2 GT1_ALG1_like 11..447 CDD:99986 185/446 (41%)
PLN02275 12..410 CDD:215155 178/410 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355186471
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H5387
Inparanoid 1 1.050 322 1.000 Inparanoid score I1463
Isobase 1 0.950 0 Normalized mean entropy S1491
OMA 1 1.010
OrthoDB 1 1.010 D330469at33208
OrthoFinder 1 1.000 FOG0003457
OrthoInspector 1 1.000 T477236
orthoMCL 1 0.900 OOG5_128548
Panther 1 1.100 LDO PTHR13036
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R40
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.