DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg1 and piga

Sequence 1:NP_650662.1 Gene:Alg1 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_002942607.2 Gene:piga XenbaseID:XB-GENE-996765 Length:492 Species:Xenopus tropicalis

Alignment Length:427 Identity:82/428 (19%)
Similarity:125/428 (29%) Gaps:157/428 (37%)


  Fly    55 QHPRCRIHELTAVPVTNLTPKLRLLFKAFWQTLSLLMALISIGRPSFLLVQNPPGIPTLIVCYLY 119
            :|..|.....||....:.||:..                 ||...|.....|..|:.:.|.....
 Frog     5 RHCSCTNPYSTATCDCHATPRFH-----------------SICMVSDFFYPNVGGVESHIYQLSQ 52

  Fly   120 CAVTR-TKLAIDWHNYTYTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQN 183
            |.:.| .|:.|..|.|           |::..:..|...|:.|:                     
 Frog    53 CLIERGHKVIIVTHAY-----------GDRKGIRYLTNGLKVYY--------------------- 85

  Fly   184 WGIGPVKVLYDRAPAQ--FHPIDL------------THKHELYLKLAKDYPQFQAKD-------- 226
               .|:||:|:::.|.  .|.:.|            .|.|..:..:|.| ..|.||.        
 Frog    86 ---LPLKVMYNQSTATTLLHSLPLLRFIFVRERVSVIHSHSSFSAMAHD-ALFHAKTMGLHTVFT 146

  Fly   227 -------AEQSDVLEATALTQKLASG----VVQYRPQRQAVL---------------VSSTSWTP 265
                   |:.|.||....||..|...    .|.|..:...||               :..|.:||
 Frog   147 DHSLFGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAIDPTDFTP 211

  Fly   266 DEDF------------------------GILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEH 306
            |...                        ||:.:..|.           ||:|..||.|:|| |..
 Frog   212 DPKIRDRSRITVVVVSRLVYRKGIDLLGGIIPEMCQR-----------YPNLHFIIGGEGP-KRI 264

  Fly   307 YVAEI-EKLQWQKVSVITPWLEIEDYPTVLASADL--------GVCLHWSTSGLDLPMKVVDMFG 362
            .:.|: |:.|......:...||.:....||...|:        ..|:. ...|....::||....
 Frog   265 ILEEVRERYQLHDRVRLLGALEHQQVRNVLVQGDIFLNTSLTEAFCMA-IVEGASCGLQVVSTRV 328

  Fly   363 SGLP---------VCAYDFKCLDELVKHGENGFVFGD 390
            .|:|         :|....|.|...::...|..:.|:
 Frog   329 GGIPEVLPENFIILCKPSVKSLCSGLEQAINRLLAGE 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 82/428 (19%)
PLN02275 7..402 CDD:215155 82/428 (19%)
pigaXP_002942607.2 GT1_PIG-A_like 28..429 CDD:99970 76/388 (20%)
RfaB 29..401 CDD:223515 75/387 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.