DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17803 and CG31365

Sequence 1:NP_001303488.1 Gene:CG17803 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:647 Identity:129/648 (20%)
Similarity:203/648 (31%) Gaps:240/648 (37%)


  Fly    80 PPPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQ-QGVKELPHHICSTCQETVNK 143
            |..|:.||.|   :..|:||..::|..:..|...::::..|.:. :....||..||..|:..:.|
  Fly     8 PDLATLCRLC---LKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEK 69

  Fly   144 SMEFRAKCQQVDKKLR----------------QTTEKYN------------IQICD--------- 171
            |..||.:||..:||||                :..:.|:            |::.|         
  Fly    70 SFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEK 134

  Fly   172 -------------------------------------EEMESELENVLYEESAQQAKGVVG---L 196
                                                 ||:.||:...|.||...|.:..:.   .
  Fly   135 WREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVS 199

  Fly   197 EDFSSELL--------------------------PDSEGVLDEDDFP------------------ 217
            ||...|.|                          |:::..:.||..|                  
  Fly   200 EDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDA 264

  Fly   218 --------LDAEPTQFSL------------SEDELDLDR----DTEKDF---------------- 242
                    .||:..:|.|            :.|.|:||.    ::.:||                
  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNG 329

  Fly   243 ---------ALEQN------------------KSCNEI-ISIRKCKTKEEIGKVDHGAKVYK--- 276
                     :.:||                  |...|| .|..|.:..|::...:.|.::.:   
  Fly   330 EIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQ 394

  Fly   277 ---------VVLGEYNSLKETAP---KYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKC 329
                     :|..|.|...|..|   |.|..|..| |....|:.|..|..:.::    ::.|..|
  Fly   395 VFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFK-QESSCPQPKTGRITDTVK----SFQCHLC 454

  Fly   330 GHTFRQRSQLQMHL------LRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPCNHCNE 388
            ...|..:..|..|.      |:..:....:||.|..:.....:...|: .:|.|..||.|:.|..
  Fly   455 PVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHM-IIHTGLKPFKCSECEL 518

  Fly   389 SFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKGLVLHM-NFHNG-SRP 451
            ||:......|| .|.|              .|..||.|.||:..:..|..|..|: ..|.| ||.
  Fly   519 SFSQREVLKRH-MDTH--------------TGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRT 568

  Fly   452 FQCKICQMKFADPSAMKRHQALHDKFPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICD 513
            .:|.:|...|...|.:.||...|......|..|.:.|..||.:.:|.   |.||..:.::.|
  Fly   569 HKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHV---TTMHKVKNKLTD 627

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 24/91 (26%)
COG5048 <323..528 CDD:227381 52/200 (26%)
zf-C2H2 324..346 CDD:278523 6/28 (21%)
C2H2 Zn finger 326..346 CDD:275368 6/26 (23%)
C2H2 Zn finger 354..375 CDD:275368 4/21 (19%)
C2H2 Zn finger 383..401 CDD:275368 6/18 (33%)
C2H2 Zn finger 426..446 CDD:275368 6/21 (29%)
C2H2 Zn finger 454..474 CDD:275368 6/20 (30%)
C2H2 Zn finger 481..501 CDD:275368 6/20 (30%)
C2H2 Zn finger 509..528 CDD:275368 1/6 (17%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 24/76 (32%)
vATP-synt_E 109..>244 CDD:304907 17/135 (13%)
RRF <161..222 CDD:294170 12/61 (20%)
zf-C2H2_8 454..530 CDD:292531 19/78 (24%)
C2H2 Zn finger 485..505 CDD:275368 4/21 (19%)
zf-H2C2_2 497..522 CDD:290200 9/26 (35%)
C2H2 Zn finger 513..533 CDD:275368 7/21 (33%)
zf-H2C2_2 526..550 CDD:290200 10/39 (26%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.