DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi1 and CG13288

DIOPT Version :9

Sequence 1:NP_001247158.1 Gene:pasi1 / 42139 FlyBaseID:FBgn0038545 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001261455.1 Gene:CG13288 / 38665 FlyBaseID:FBgn0035648 Length:273 Species:Drosophila melanogaster


Alignment Length:181 Identity:52/181 - (28%)
Similarity:79/181 - (43%) Gaps:44/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVVLSSCWSPIIWSDNVRTGSYAVAGYTA---ALSAVMITLISYM------LAGGESAQLYSPLF 56
            |.:|.||   ..|.| ||:||:|.|.||.   ..|.:|  .:.|:      |.|..:..|...|.
  Fly     1 MAILESC---CFWKD-VRSGSFACAIYTLVYFGFSTLM--FLFYLIEEQDFLLGNRAQPLGESLL 59

  Fly    57 ETDIRSSMPVAGGFFIIYFL----LIILSSYLVYYGIKISTRGWLLPWLG------------LIG 105
            |   :..:.|....|.|..|    |::|||.|:..|::.:.|..|:||:.            |:.
  Fly    60 E---KGDVTVVTVIFNILLLFCSILMVLSSVLLILGLQQNKRHLLIPWISFMLGDLLIEVCHLVH 121

  Fly   106 LAILFQFSWSLWLIGGYYIYLEQTFSALLNFVWVAYNIYCWLVVFSQYQIF 156
            ||:..:..:.. ::|         |...::|..:..|:||.|.|.||||.|
  Fly   122 LALSRRVKFDP-IVG---------FIFTMDFFLLCLNLYCLLCVISQYQTF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pasi1NP_001247158.1 DUF4728 76..156 CDD:292485 26/95 (27%)
CG13288NP_001261455.1 DUF4728 75..163 CDD:292485 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36694
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.