DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14321 and AT5G17610

Sequence 1:NP_650650.1 Gene:CG14321 FlyBaseID:FBgn0038540 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_568353.1 Gene:AT5G17610 AraportID:AT5G17610 Length:121 Species:Arabidopsis thaliana

Alignment Length:79 Identity:27/80 (34%)
Similarity:40/80 (50%) Gaps:12/80 (15%)


  Fly    50 SKNEITYHELEVTCDQHAQCIGLSPVG----------VAKINCIRQCISPSCYQDIYAFNELEEG 104
            ||:.....::|:. .:.::|.|....|          :||.||..:|:||.|||.||..:.||||
plant    28 SKSPRPISDVEIR-QKKSECYGDIESGLWGWQCKSSAIAKENCALRCLSPVCYQLIYESDPLEEG 91

  Fly   105 EID-ARLNSFKGCV 117
            |.| .|...:|.|:
plant    92 EKDLIRSQEYKYCM 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14321NP_650650.1 DUF4787 53..116 CDD:292648 24/74 (32%)
AT5G17610NP_568353.1 DUF4787 36..104 CDD:292648 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193330
orthoMCL 1 0.900 OOG5_146368
Panther 1 1.100 LDO PTHR35455
Phylome 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.