DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and Arid4b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_919238.1 Gene:Arid4b MGIID:2137512 Length:1314 Species:Mus musculus

Alignment Length:312 Identity:72/313 (23%)
Similarity:115/313 (37%) Gaps:51/313 (16%)


  Fly   805 MPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQDNGISSSGPT 869
            :|:..|.|.|.|    .:|..|:...:|..:    |:.:.:|...:....|....|         
Mouse   123 LPLTNPEHFGTP----VIGKKTNRGRRSNHI----PEEESSSSSSDDDEEERKQTD--------- 170

  Fly   870 GAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKND------------- 921
                 ..:..||       .:|.||.:...:....|....|.|:...:.|.|             
Mouse   171 -----ELLGKVV-------CVDYVSLEKKKAMWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFT 223

  Fly   922 --PYSQSHLAPPSTSPHP-VVMHPGGGPGEEYDMSS--PPNWPRPAGSPQVFNHVPVPQEPFRST 981
              |....|.....|.|.| .|:........|:..|.  |.||..........:.....:|  ...
Mouse   224 SVPRKDVHEITSDTVPKPDAVLKQAFDQALEFHKSRAIPANWKTELKEDSSSSEAEEEEE--EED 286

  Fly   982 ITTTKKSDSLCKLYEMDDNP-DRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERG 1045
            ....|:.:|..:..|::..| :|..:|.:|..|||:|.|||...|.:..:.|:|::|:..|.:.|
Mouse   287 DEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLG 351

  Fly  1046 GFVEVTKSKTWKDIAGLLGIGASSSAA-YTLRKHYTKNLLTFECHFDRGDID 1096
            ||..:.....||.:...|||...:||| |.::..|.|.|..||.:....:||
Mouse   352 GFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANID 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 33/93 (35%)
DUF3518 2191..2451 CDD:288854
Arid4bNP_919238.1 TUDOR 58..113 CDD:197660
RBB1NT 169..262 CDD:285392 19/114 (17%)
ARID 311..394 CDD:198082 30/83 (36%)
Tudor-knot 571..624 CDD:288553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.