DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and LFR

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_566721.1 Gene:LFR AraportID:AT3G22990 Length:460 Species:Arabidopsis thaliana

Alignment Length:480 Identity:91/481 (19%)
Similarity:168/481 (35%) Gaps:138/481 (29%)


  Fly  2066 NSTEEQTFNKKRRLVSGGSSSSGAHAEGKKSKLT-------------SEEFAQPNAEVKKEPGTA 2117
            ||..||   ..||:|.       |...|.||::|             .|:..:....:.|..|..
plant    61 NSFVEQ---NNRRIVL-------ALQSGLKSEVTWALNTLTLLSFKEKEDIRRDVMPLAKIAGLL 115

  Fly  2118 DSDCRPVD--MDIEAPQQRLTNG--VAPCSSTPAI------FDPRTT--------AKDEARVLQR 2164
            |:....:|  .||..|:. ||.|  |....:..::      :|...:        ....|..|.:
plant   116 DALLLIIDDWRDIALPKD-LTRGTRVRTLGTNASVTGFGNEYDALASIQPPGSGIGSSAAEALGK 179

  Fly  2165 RRDSSFEDECYTRDEASLHLVSESQDSLARRC-IALSNIFRNLTFVPGNETVLAKSTRFLAVLGR 2228
            :.....:...:..:|..|..:.:...|..:.| ||.||:.||.:|:|.||.|:|:....|..:.:
plant   180 KSTGKHQSSQWWMEEDGLFNLDDEGRSEKQMCAIAASNVIRNFSFMPDNEVVMAQHRHCLETVFQ 244

  Fly  2229 LLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELS 2293
            .:   |:|:           .||.:                  |:|   |.|..:.|:|..::|.
plant   245 CI---HDHM-----------TEDEE------------------LVT---NSLETIVNLAHLMDLR 274

  Fly  2294 RY----------DELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTD 2348
            .:          :|..|...:.|:|:                  :||.:....|.|.|.:|.:..
plant   275 IFSSLKQSYININEKKAVQAVVGILN------------------SSVKAWNCAAAELLGRLIINP 321

  Fly  2349 ANVDLVIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVALQSPCISY 2413
            .|...:  :|...::.|              :::...|:..:...|||..|:...|.:...|...
plant   322 DNEPFI--SPLIPQIHK--------------RLIDLLSIQAVDAQAAAVGALYNLVEVNMDCRLK 370

  Fly  2414 LVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQQEQRL 2478
            |.:.....::....:...|.:.             ::.|:||..|.:|...|.||.|.:..|...
plant   371 LASERWAVDRLLKVIKTPHPVP-------------EVCRKAAMILENLVSEPQNRGLLLAYENAF 422

  Fly  2479 LGLVMSHILDQQVALIISRVLYQVS 2503
            ..|:..   :.:.:...:|:||:::
plant   423 AELLFQ---EGKYSDSFARILYELT 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777
DUF3518 2191..2451 CDD:288854 48/271 (18%)
LFRNP_566721.1 DUF3518 212..>235 CDD:288854 12/23 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12656
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.