DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and arid3b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_005163185.1 Gene:arid3b ZFINID:ZDB-GENE-070209-182 Length:616 Species:Danio rerio

Alignment Length:674 Identity:154/675 (23%)
Similarity:230/675 (34%) Gaps:205/675 (30%)


  Fly   804 GMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGP----------ESGGPEHIS 858
            |.|:.|..:              |...:.:.|:||  ||..|:.||          |....|   
Zfish    87 GAPLTPDFY--------------SKNSRDRALKGG--QGPLAARGPVKTASDLAHEEDAADE--- 132

  Fly   859 QDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVS-----QQSTLSNASAASGEDP-----QCT 913
            .|.|      .|:.|.......:..|.||:..:|..     ::.:|:...||.|..|     ...
Zfish   133 MDRG------RGSEGDEDDDDEMMDGEDGSEEEESEGLEFLRKQSLALQQAAVGVPPYSFPVYTA 191

  Fly   914 TPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSP---PNWPRPAGSPQVFNHVPVPQ 975
            :|.:.|..|.|      |:|.   |...|.....::...::|   .:|..              .
Zfish   192 SPSAAKKRPLS------PTTK---VKDEPEDSLSDQQSFNTPNGMGDWNL--------------D 233

  Fly   976 EPFRSTITTT------------KKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTIS 1028
            :.|:....::            :.|....||||:|::|.|:.:||.|.|:|::|.||:...|.::
Zfish   234 DSFKQNGNSSWNEEGDGGRSRGEASRDFAKLYELDNDPKRKEFLDDLFAYMQKRGTPVNRIPIMA 298

  Fly  1029 KQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYTKNLLTFECHFDR 1092
            ||.||||.||..|.|:||.|||...|.|::|...|.:..| :|||:|||..|.|.|..:||    
Zfish   299 KQVLDLYMLYKLVTEKGGLVEVINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYPYEC---- 359

  Fly  1093 GDIDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNS------TGSSNSQDSF-PAPPGSA 1150
                            :||     .:.||  |.|.|...::      .|.|||...| |:|.|:|
Zfish   360 ----------------EKK-----GLSSP--GELQAAIDSNRREGRRPGYSNSLYRFSPSPSGAA 401

  Fly  1151 PNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNN--PQTPHPGAAAAVAAGDNISVSN 1213
            |:                :.|.|        :|..|.:.:|  ..||.|....|....|:.:...
Zfish   402 PH----------------LLSPP--------KMHLPATGHNELQATPSPALKKATVPEDSPASML 442

  Fly  1214 PFEDPIAAGGGPGSGTGPGPGQGPGPGAAS---------GGAGAVGAVGGGPQPHPPPPHSPHTA 1269
            |...|:|...|         .|.....||:         .|.|| |||..||.....|.......
Zfish   443 PARLPLALALG---------HQQQLARAATLEQLRERLETGMGA-GAVNAGPAVVEGPERKMARL 497

  Fly  1270 AQQAAGQHQQQHPQHQHPGLPGPPPPQQQQG-----QQGQQPPPSVGGGPPPAPQQHGPGQVPPS 1329
            |::.....||...|:.........|...:..     ::.|....|:        ..:|...:..|
Zfish   498 AEEQQRLLQQAFQQNLLAMASQVNPTNLRMNNANTREEKQDLSLSI--------SSNGSASITVS 554

  Fly  1330 PQQHVRPAAGAPYPPGGSGYPTPVSRT-PGSPYPSQPGAYGQYGSSDQYNATGPPGQPFGQGPGQ 1393
            .:.:....:|:.|.......||.|:.. ||......||......||..                 
Zfish   555 VEVNGIIYSGSLYAQKSGSVPTAVTAMFPGHTSTLSPGVASSSSSSSS----------------- 602

  Fly  1394 YPPQNRNMYPPYGPEGEAPPTGAN 1417
                       .||:...|.||.:
Zfish   603 -----------KGPDSVDPATGGS 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 42/92 (46%)
DUF3518 2191..2451 CDD:288854
arid3bXP_005163185.1 BRIGHT 271..363 CDD:128777 44/117 (38%)
DUF4251 <523..566 CDD:290766 5/51 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
21.990

Return to query results.
Submit another query.