DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and arid1b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_005160411.1 Gene:arid1b ZFINID:ZDB-GENE-030131-4459 Length:2170 Species:Danio rerio

Alignment Length:2625 Identity:749/2626 (29%)
Similarity:1001/2626 (38%) Gaps:727/2626 (28%)


  Fly    41 GPPTPNNNSNN---GSDPSIQQQQQNVAP--HPYGAPPPPGSGPGGPPGPDPAAVMHYHHLHQQQ 100
            ||.:.|||:||   |...:.|....:|:.  :.|      |:|.|||        ....|..||.
Zfish   111 GPASNNNNNNNSGGGGGSASQSGSSSVSEFNNYY------GNGRGGP--------CFDQHGGQQS 161

  Fly   101 QQ----HPPPPHMQQQQ-----HHGGPAPPPPGGAPEHAPGVKEEYTHLP---PPHPHPAYGRYH 153
            .:    |..|.:|.|.|     :|..|                  |.|.|   |.:....||.  
Zfish   162 PRTALIHQAPGNMDQVQNSHEGYHNNP------------------YNHYPNYRPGYGGAGYGM-- 206

  Fly   154 ADPNMDPYRYGQPL-PG-GKPPQQQQPHPQ-QQPPQQPGPG---GSPNRPPQQRYIPGQPPQGPT 212
                |.|.|.|..: || ..|......|.: ......|.||   ||..|.|.|..   |.|.|.|
Zfish   207 ----MSPSRQGNMMGPGTNSPTAAAASHGKAAMASTTPAPGANVGSFQRFPGQNQ---QHPSGAT 264

  Fly   213 PTLNSLLQSSNPPPPPQHRYANTYDPQQAAASAAAAAAAQQQQAGGPPPPGHGPPPPQHQPSPYG 277
            ||||.||.|   |.|....|...|.......|       ||||:|    .|.|    :...|||.
Zfish   265 PTLNQLLTS---PSPMMRGYGGGYQDYSNPPS-------QQQQSG----MGLG----KDMSSPYS 311

  Fly   278 -GQQGGWAPPPRPYSPQLGPSQ------QYRTPPPTNTSR------GQSPY-------------P 316
             .....||...|.: |.:.|..      |..|..|....|      |.:||             |
Zfish   312 PAASHSWAAQQRNH-PAMSPGNNGNSRAQVATMDPMTMKRSQMYGMGNNPYSQQGTYAGQPYGSP 375

  Fly   317 PAHG-----QNSGSYPSSPQQQQQQQQQQQQQAGQQPGGPVPGGPPPGTGQQPPQQNTPPTSQYS 376
            .||.     |..|.......|..||||...|...|...|....|.||..  .||||.:...|| .
Zfish   376 TAHRYPMGMQGRGQVGIGGMQYSQQQQMPAQYGPQGMSGYCQQGQPPYF--SPPQQQSAAPSQ-P 437

  Fly   377 PY-PQRYPTPPGL---------PAGGSNHRTAYSTHQYPEPNRPWPGGSSPS-PGSGHPLPPASP 430
            || .||.||....         .:|..||.....|.|    :||   .|.|. .||...||..:.
Zfish   438 PYMQQRAPTQQDTLQEGYGSRGQSGKPNHDDMGLTQQ----DRP---SSLPDLSGSIDDLPTGTE 495

  Fly   431 HHVPPLQQQPPPPPHVSAGGPPPSSSPGHAPSPSPQPSQASPSPHQELIGQNSNDSSSGGAHSGM 495
            ..:...         |||.|  .:||.|...:|:..|.....||..                ..|
Zfish   496 AGLSSA---------VSASG--STSSQGEQSNPAQSPFSPHASPRV----------------PSM 533

  Fly   496 GSGPPGTPNPQQVMRPTPSPTGSSGSRSMSPAVAQNHPISRPASNQSSSGGP-MQQPPVGAGGPP 559
            .|||  :|:      |..||.|||.|||        .||| |||      || .|..|...|..|
Zfish   534 RSGP--SPS------PVGSPVGSSQSRS--------GPIS-PAS------GPGTQMAPQTPGNVP 575

  Fly   560 PMPPHPGMPGGPPQQQQSQQQQASNSASSASNSP--QQTPPPAPPPNQGMNNMATPPPPPQGAAG 622
            .:..|......|..|::.   .|||...:|..|.  .|.|.|:..|:.          .|.|   
Zfish   576 DVGSHSTHSQSPMSQERG---YASNMQRNAPGSQFGGQQPGPSMSPHS----------CPTG--- 624

  Fly   623 GGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYPPRPQY--PPGAYATGPPPPPTSQA 685
               || .|..|.|:||        ..|.||..|..|.||||....|  .|||..:||.|...:..
Zfish   625 ---PM-HHSVGSYQMG--------PSYGPQSGQYGPSGNYPRPANYGGAPGANYSGPGPGMGNSL 677

  Fly   686 GAGGANSMPSGAQAGGYP------GRGMPNHTGQYPPYQWVPPSPQQTVPGGAPGGAMVGNHVQG 744
            |...  |.|...|..|.|      .|| |.|.....||    |:...:|...:|      |..|.
Zfish   678 GMNA--SSPMHGQGPGQPCGSMTTARG-PGHAAGGRPY----PAGSSSVAPTSP------NMPQS 729

  Fly   745 KGT---PPPPVVGGPPPPQGSGSPRPLNYLKQHL----QHKGGYGGSPTPPQGPQGYGNGPTGMH 802
            .|.   ||||.||..|...|..|      .:|:|    |.:..:|.||..|    |. :||.|..
Zfish   730 AGPGMGPPPPNVGRKPHESGPAS------AQQNLVPSSQARPPFGRSPVYP----GL-SGPGGRP 783

  Fly   803 P-GMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQ-----GASGGPE-----SGGPEH 856
            | ...:..|||   ||..:..|.             |||..:     |..||..     .|||..
Zfish   784 PASFSLPQPHH---PHYSSGQGQ-------------GQPHAELYGPAGYQGGSHMLGMGPGGPYS 832

  Fly   857 ISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNAS-AASGEDPQCTTPKSRKN 920
            :...|..:...|.|.:     .:.:.|||...|.|.:........|. ...|..|....||.:.|
Zfish   833 LPPSNSSARMTPQGPS-----YNTMPTGPMTGSGDTMMPTDPKQRAEHKEEGSTPATEPPKPKDN 892

  Fly   921 DPY-SQSHLAPPSTSP-HPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTIT 983
              | ||....||:.|| .|.........|::.|..|.|.||:.            |..|..||:.
Zfish   893 --YGSQCVSQPPTPSPLSPSPASLSSYQGDDSDSISSPAWPKN------------PSSPKHSTVN 943

  Fly   984 TTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFV 1048
            .|  ::.:.:||:|...|:||.|:|:..||||||.||:...|::.|:||||.|||:.|:|.||..
Zfish   944 MT--NEKITRLYDMGCEPERRAWVDRYIAFMEERGTPVPNLPSVGKKPLDLCRLYLCVREIGGLA 1006

  Fly  1049 EVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTA 1113
            .|.|:|.|::::..|.:|.|||:|.:|:|.|.:.|..:||..:||: :|.|....:..|.|::..
Zfish  1007 MVNKNKKWRELSTHLNVGTSSSSASSLKKQYIQYLFAYECKVERGE-EPPPDAFAMGDGKKQQQQ 1070

  Fly  1114 KAASVPSP-GGGHLDA-GTTNSTGSSNSQ----DSFPAPPGSAPNAAIDGYPGYPGGS---PYPV 1169
            .....||| ..|.|.. .|..|||||...    |..|..|.:.|:..:...|......   ..|.
Zfish  1071 AKIQPPSPANSGSLQGPQTPQSTGSSTMTEMPGDLKPPTPATTPHGQVTPQPAVRNSGISVQDPF 1135

  Fly  1170 ASGPQPDYATAGQMQRPPSQNNPQTPHPGAAAAVAAGDNISVSNPFEDPIAAGGGPGSGTGPGPG 1234
            :.|..|.:...|.|            |.|:..|.:.....:..:||  ..|..||..|..   ||
Zfish  1136 SEGSDPAFQKRGPM------------HGGSGDATSRMQFDTSKDPF--GAARKGGSESFV---PG 1183

  Fly  1235 QGPGPGAAS-GGAGAVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQHQHPGLPGPPPPQQQ 1298
            |.||.|... ...|....:|.||:|            |.:.....::.|.|    :.||......
Zfish  1184 QMPGSGMQEMYSRGPSSGMGMGPRP------------QYSYNPGFERRPDH----VMGPEGGIAA 1232

  Fly  1299 QGQQGQQPP----PSVGGGPPPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGS 1359
            .|.|....|    ||:..|...|..|          .:|           |..||        |.
Zfish  1233 SGNQNNMVPSSSDPSMFSGSRYASHQ----------SRH-----------GHDGY--------GQ 1268

  Fly  1360 PYP-SQP-GAYGQYGSSDQYNATGPPGQPFGQGPGQY-PPQNRNMYPPYGPE-GEAPPTGANQYG 1420
            .|| |.| ||:|.|.....|..   ||:      |.| ||..|:....||.: |...|...:|||
Zfish  1269 QYPHSMPYGAHGMYPQQQGYKR---PGE------GMYGPPAKRHESEAYGMQYGGQQPDMYSQYG 1324

  Fly  1421 PYGSRPYSQP----------PPGGPQPPTQTVAGG--PPAGGAPGAPPSSAYPTGRPSQQDYYQP 1473
            ....||...|          .|||..||..::..|  ||:..:.|.|..:.:.|           
Zfish  1325 YPERRPMQSPFPYGYGRDRMQPGGQGPPQHSMMSGGPPPSSNSSGGPQGNMWHT----------- 1378

  Fly  1474 PPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSGTQQYRPQYPSSPAPQNWGGAPPRGAAPP 1538
                     || |.   :.|||               |:|                         
Zfish  1379 ---------RH-DM---AYPYP---------------TRQ------------------------- 1390

  Fly  1539 PGAPHGPPIQQPAGVAQWDQHRYPP-QQGPPPPPQQQQQPQ-QQQQQPPY-QQVAGPPGQQPPQA 1600
               .||||              ||. .:|..|..:..|:.| ..|:|.|| ...:......||.|
Zfish  1391 ---SHGPP--------------YPSMSRGDDPEARVSQESQWPGQRQSPYPSHSSSSSSSMPPMA 1438

  Fly  1601 PPQWAQMNPGQTAQSGIAPPGSPLRPPSGPGQQNRMPGMPAQQQQSQQQGGVPQPPPQQASHGGV 1665
            ..|               ||.|...||:.|...:|                ||.|.|...|.||.
Zfish  1439 SRQ---------------PPSSYQSPPAMPNHISR----------------VPSPAPFPRSVGGS 1472

  Fly  1666 PSPGLPQVGPGGMVKPPYAMPPPPSQGVGQQVGQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSH 1730
            .||....:                               |.|.|....||               
Zfish  1473 MSPTKAHM-------------------------------MASLKQMQKPG--------------- 1491

  Fly  1731 QHPHPHQHPQHQHPHQMPPNQTAPGGYGPPGMPGGGAQLVKKELIFPHDSVESTTPVLYRRKRLM 1795
                        .|..||.:|:.       |:||.|...:.:|:.:|.||||:|.|.|..|:||.
Zfish  1492 ------------GPVSMPSSQSG-------GLPGQGFSSIHREVNYPLDSVEATQPQLKPRRRLT 1537

  Fly  1796 KADVCPVDPWRIFMAMRSGLLTECTWALDVLNVLLFDDSTVQFFGISNLPGLLTLLLEHFQKNLA 1860
            ..|:...:.||:.|:::||||.|.|||||.:|:||:||:||..||:|.|||.|.|::|.|::.|.
Zfish  1538 SKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFGLSQLPGFLELIVEFFRRCLI 1602

  Fly  1861 EMF---DERE--NEEQSALLAEDADDDADSGTVMCEKLRTSGRQPRC----VRSISSYNRRR--- 1913
            |:|   :|.|  .|.|..||...::.             |..:||..    .:||:.:..:|   
Zfish  1603 EIFGILEEYEVGTEGQKTLLGSCSEP-------------TEKQQPSTPDFKSQSIAEHVEKRLDV 1654

  Fly  1914 --------------HYENMDRSGKDGAGNGSDSEDADEGIDLGQVRVQPNPEERSLLLSFTPNYT 1964
                          ..|..:.|.:|.|    |.|:.:.|.| ....|:|.|::.|       .|.
Zfish  1655 EPEKPQPSSSAAALVMEKKEESAEDKA----DDEEKNTGKD-PCPPVEPRPKQAS-------KYD 1707

  Fly  1965 MVTRKGVPVRIQ--PAENDIFVDERQKAWDIDTNRLYEQLEPVGSDAWTYGFTEPDPLDGIIDVF 2027
            .     :||:|:  .||.|. |::|.:                              |.|:...|
Zfish  1708 R-----LPVKIEEKDAEEDC-VEDRSE------------------------------LLGLAGEF 1736

  Fly  2028 KSEIVNIPFARYIRSDKKGRKRTELASSSRKPEIKT--EENSTEEQTFNKKRRLVSGGSSSSGAH 2090
            ||                |....:.........|:|  |.:..|||..          .:..|..
Zfish  1737 KS----------------GLLHWKAGGGDSTAHIQTYFERSWEEEQPL----------ENQEGVQ 1775

  Fly  2091 AEGKKSKLTSEEFAQPNAEVKKE-PGTADSDCRPVDMDIEAPQQRLTNGVAPCSSTPAIFDPRTT 2154
            |.||:   |.||..:...|:|:| ||.::.:......|:      |.:.....|...:...|..|
Zfish  1776 AIGKE---TVEEQPRGQEELKRELPGPSEENLTATVDDV------LKSNPGSISEGESQTFPFRT 1831

  Fly  2155 AKDEARVLQRRRDSSFEDECYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLAKS 2219
            .::::.:      :..|||....|||.|.:....||.||:|||.:|||.|.|:|||||:..||:.
Zfish  1832 RENKSSI------TLLEDEPRCWDEAPLSVAESWQDELAKRCICVSNIIRGLSFVPGNDNELARH 1890

  Fly  2220 TRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMA 2284
            ...:.:||:|:||:|||.:|......|.|||:...  :||    :.|||||.|..:|||.||.:|
Zfish  1891 PGLVLILGKLVLLHHEHPKRKRMPATYQREEERGL--ACS----KDEWWWDCLGALRENTLVTLA 1949

  Fly  2285 NIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDA 2349
            ||:|.|:||.|.|.|..|::||||||.|||||..||||.:....|.|:||||.||.||||.:.|:
Zfish  1950 NISGQLDLSVYPESICLPILDGLLHWMVCPSAEAQDPFCTANGFSSLTPQRLVLECLCKLSIQDS 2014

  Fly  2350 NVDLVIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVALQSPCISYL 2414
            ||||::|||||.|.|:|.|.|.||:...:.||.||.:|.:|..||..|...||.||||...:..|
Zfish  2015 NVDLLLATPPFGRQERLFATLVRHVGDRKSQVCREMAVAVLSNLAQGDPTAARAVALQKGSVGAL 2079

  Fly  2415 VAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQQEQRLL 2479
            ::|:|.:...|....:.|.:.::..:......|::|:.|||..||.:||..:||..|:..|.|||
Zfish  2080 ISFLEDSVAMAQYQQSPHSLLHMGHSTQHEPPSINMMCRAAKALLAMAKVEENRPEFVLFESRLL 2144

  Fly  2480 GLVMSHILDQQVALIISRVLYQVSR 2504
            .:.:|.:|:..||.|:..||:::.|
Zfish  2145 DISLSSVLNSGVAAILCEVLFKLGR 2169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 42/91 (46%)
DUF3518 2191..2451 CDD:288854 120/260 (46%)
arid1bXP_005160411.1 Med15 254..>717 CDD:255446 167/580 (29%)
Med15 508..>940 CDD:255446 154/558 (28%)
BRIGHT 959..1050 CDD:128777 42/91 (46%)
DUF3518 1862..2116 CDD:288854 120/260 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112457788
eggNOG 1 0.900 E1_KOG2510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 564 1.000 Inparanoid score I1019
OMA 1 1.010
OrthoDB 1 1.010 D135670at33208
OrthoFinder 1 1.000 FOG0001960
OrthoInspector 1 1.000 T596925
orthoMCL 1 0.900 OOG5_131090
Panther 1 1.100 LDO PTHR12656
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4068
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.