DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and arid3c

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_005165415.1 Gene:arid3c ZFINID:ZDB-GENE-060526-12 Length:599 Species:Danio rerio

Alignment Length:473 Identity:116/474 (24%)
Similarity:159/474 (34%) Gaps:148/474 (31%)


  Fly   811 HHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQDNGISSSGPTGAAGMH 875
            |:.....|....|.|.|                 :||.|.....|....|.......|....||.
Zfish    91 HYQAAVRGAFAAGVPNS-----------------SSGHPLERRAESDIDDEDDEDDDPELDRGMD 138

  Fly   876 AVTSVVTTGPDGTSMDEVSQQSTLSNASA----------ASGEDPQCTTP--KSRKNDPY----- 923
            .....:   .:..||:|......|....|          .:|:.|: :||  .||...||     
Zfish   139 DEERDM---DEDDSMNEGGGDEDLEGPLAHYPPRHAVYPGAGQSPK-STPIHLSRVQPPYPAPRQ 199

  Fly   924 --SQSHLAPPSTSPHPVVMH------------PGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVP 974
              |.|.|||.:.|.|    |            .|.|||.:...||...  ...||          
Zfish   200 AESPSALAPQAQSQH----HEWTYEEQFKQSGQGSGPGRKLKDSSVAF--GGGGS---------- 248

  Fly   975 QEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYI 1039
                         |..:.:|||:||:..|:.:||.|.:||::|.||:...|.::||.||||.||.
Zfish   249 -------------SSLIQELYELDDDEKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLYTLYK 300

  Fly  1040 YVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYTKNLLTFECHFDRGDIDP------ 1097
            .|.|:||.|||...|.|::|...|.:..| :|||:|||..|.|.|..:||. .||...|      
Zfish   301 LVTEKGGLVEVINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECE-KRGLSSPGELQAA 364

  Fly  1098 --------------------LPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDS 1142
                                .|:.......|.|......|:|:|.|||:     ..|.....:||
Zfish   365 IDSNRREGRRQSYGSTLFNYSPVGTPTLLASPKLQMPHISMPTPNGGHM-----TQTPGIKKEDS 424

  Fly  1143 FPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAAAAVAAGD 1207
            .       .::.:....|.|              .:.||.             |..|.||.||..
Zfish   425 M-------LSSCLTNRVGIP--------------MSLAGH-------------HSAAQAAAAAAV 455

  Fly  1208 NISVSNPFEDPIAAGGGP 1225
            ..:......:.:.:|..|
Zfish   456 QAAALEQLREKLESGEPP 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 41/92 (45%)
DUF3518 2191..2451 CDD:288854
arid3cXP_005165415.1 BRIGHT 262..354 CDD:128777 42/93 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
21.990

Return to query results.
Submit another query.