DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and Arid3b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_062663.1 Gene:Arid3b MGIID:1930768 Length:568 Species:Mus musculus

Alignment Length:495 Identity:128/496 (26%)
Similarity:189/496 (38%) Gaps:99/496 (20%)


  Fly   767 PLNYLKQHLQHKGGYGGSPTPP---------QGPQG------YGNGPTGMHPGMPMGPPHHMGPP 816
            ||...:|..|.|     .|..|         ||||.      |.: ..|..|.:....|   |.|
Mouse     3 PLQQQQQQQQQK-----QPQQPLLQMDAREKQGPQTRESQFLYAS-KLGTQPALLSITP---GRP 58

  Fly   817 HGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQDNGISSSGPTGAAG----MHAV 877
            .|.:.:||....||.:.:.:..:.....:....|.||.|....|:.::......|..    .|  
Mouse    59 SGSSVLGPLARVPPATPVARMSEQSNVNSEPEEEEGGLEDEDGDDDVAEVAEKEAQAASKYFH-- 121

  Fly   878 TSVVTTGPDGTSMDEVSQQ----STLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPV 938
                        |.:|::|    :.:|:.....|..||   .:..|.|....:..||||.   |.
Mouse   122 ------------MQKVTRQEPRATPMSSLLPVPGLSPQ---GQQTKEDHTKDASKAPPSV---PT 168

  Fly   939 VMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDR 1003
            ...|.....|:...:....|...|...:                 ..:.|....||||:|.:|:|
Mouse   169 AGQPSWSLDEQLKQNGALAWSDDADGGR-----------------GREISRDFAKLYELDGDPER 216

  Fly  1004 RGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGAS 1068
            :.:||.|..||::|.|||...|.::||.||||.||..|.|:||.||:...|.|::|...|.:..|
Mouse   217 KEFLDDLFIFMQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTS 281

  Fly  1069 -SSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTN 1132
             :|||:|||..|.|.|..:||                   .||..:..|.:.:...|:...|...
Mouse   282 ITSAAFTLRTQYMKYLYAYEC-------------------EKKALSSPAELQAAIDGNRREGRRP 327

  Fly  1133 STGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAG-QMQRPPSQNNPQTPH 1196
            |..||....|..|...:|..||.........|:| .:.|.|:..::..| ......|.::|:.| 
Mouse   328 SYSSSLFGYSPAAAAAAAAAAAAAAASAASAGTP-ALLSSPKIRFSILGLGSSSGTSASSPRIP- 390

  Fly  1197 PGAAAAVAAGDNISVSNPFEDPIAAGG---GPGSGTGPGP 1233
              .|:.:..||.:.|  |..:.:|..|   |..:|..|||
Mouse   391 --PASTLRKGDGVPV--PVPNRLAVSGTLAGQQAGNRPGP 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 42/92 (46%)
DUF3518 2191..2451 CDD:288854
Arid3bNP_062663.1 Interaction with RB1. {ECO:0000250} 201..374 65/193 (34%)
BRIGHT 214..303 CDD:128777 42/108 (39%)
Interaction with ARID3A. {ECO:0000250} 495..518
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
21.990

Return to query results.
Submit another query.