DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and Arid3c

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_001017362.1 Gene:Arid3c MGIID:3650624 Length:409 Species:Mus musculus

Alignment Length:611 Identity:137/612 (22%)
Similarity:191/612 (31%) Gaps:268/612 (44%)


  Fly   818 GPTNMGPPTSTPPQSQMLQGGQ----PQGQ-GASGGPESGGPEHISQDNGISSSGPTGAAGMHAV 877
            ||  :.||....||..:| |.:    |:|. |..|..|..|.|        ...|.|..|     
Mouse    17 GP--LAPPRLPLPQPPLL-GARTLQAPEGAIGVVGAEEEEGAE--------DEEGETPLA----- 65

  Fly   878 TSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHP 942
                        .:|.::||           .|....|    |.|.|||    |...||      
Mouse    66 ------------EEETAEQS-----------HPGARCP----NSPSSQS----PGIQPH------ 93

  Fly   943 GGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWL 1007
                          .|              ..:|.|:             :|||:|.:|.|:.:|
Mouse    94 --------------EW--------------TYEEQFK-------------QLYELDADPKRKEFL 117

  Fly  1008 DKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSA 1071
            |.|.:||::|.||:...|.::||.||||.|:..|..:||.|||...|.|:::...|.:..: :||
Mouse   118 DDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSA 182

  Fly  1072 AYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGS 1136
            |:|||..|.|.|..:||.                       .:|.|.|    |.|.| ..:|...
Mouse   183 AFTLRTQYMKYLYPYECE-----------------------TRALSSP----GELQA-AIDSNRR 219

  Fly  1137 SNSQDSFPAPP-----GSAPNAAIDGYPGYPGGSPYPVAS-GPQPDYATAGQMQRPPSQNNPQTP 1195
            ...:.::.|.|     |..|.           |:|.|.:| ||.|   ||             ||
Mouse   220 EGRRQAYTAVPLFNLAGPTPR-----------GAPGPASSHGPAP---TA-------------TP 257

  Fly  1196 HPGAAAAVAAGDNISVSNPFEDPIAAGGGPGSGTGPGPGQGPGPGAASGGAGAVGAVGGGPQPHP 1260
            :                                 .|||.||...|..:.....:       .|.|
Mouse   258 N---------------------------------CPGPTQGSASGLPAHACAQL-------SPSP 282

  Fly  1261 --------PPPH--SPHTAAQQAAGQHQQQHPQHQHPGLPGPPPPQQQQGQQGQQPPPSVGGGPP 1315
                    |||.  .|...|.:|.  .::..|:.         ||:::....|....|.:|..|.
Mouse   283 VKKEESGIPPPRLALPMGLASEAT--REKLAPEE---------PPEKRAVLMGPVDSPRLGAPPS 336

  Fly  1316 PAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSG-----------------------YPTPVSRTP 1357
            ..|:    |:.|...::     ...|....|||                       .|.|.|..|
Mouse   337 FLPR----GKAPLREER-----LDGPLNLAGSGISSINVALEINGVVYTGILFARRQPVPASLGP 392

  Fly  1358 GSPYPSQPGAYGQYGSSDQYNATGPP 1383
            .:| |..|             :||||
Mouse   393 TNP-PPLP-------------STGPP 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 38/92 (41%)
DUF3518 2191..2451 CDD:288854
Arid3cNP_001017362.1 BRIGHT 111..202 CDD:128777 38/114 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
21.990

Return to query results.
Submit another query.