DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and ARID4B

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_001193723.1 Gene:ARID4B HGNCID:15550 Length:1312 Species:Homo sapiens

Alignment Length:304 Identity:71/305 (23%)
Similarity:114/305 (37%) Gaps:53/305 (17%)


  Fly   805 MPMGPPHHMGPP--HGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGP------------- 854
            :|:..|.|.|.|  ...||.|..::..|:.:         ..:|...|....             
Human   123 LPLTNPEHFGTPVIGKKTNRGRRSNHIPEEE---------SSSSSSDEDEDDRKQIDELLGKVVC 178

  Fly   855 -EHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSR 918
             ::||.|...:...|           .:...||  ..||::.:.  .|....|.:|.:.|:.   
Human   179 VDYISLDKKKALWFP-----------ALVVCPD--CSDEIAVKK--DNILVRSFKDGKFTSV--- 225

  Fly   919 KNDPYSQSHLAPPSTSPHP-VVMHPGGGPGEEYDMSS--PPNWPRPAGSPQVFNHVPVPQEPFRS 980
               |....|.....|:|.| .|:........|:..|.  |.||..........:.....:|  ..
Human   226 ---PRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEE--EE 285

  Fly   981 TITTTKKSDSLCKLYEMDDNP-DRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKER 1044
            .....|:.:|..:..|::..| :|..:|.:|..|||:|.|||...|.:..:.|:|::|:..|.:.
Human   286 DDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKL 350

  Fly  1045 GGFVEVTKSKTWKDIAGLLGIGASSSAA-YTLRKHYTKNLLTFE 1087
            |||..:.....||.:...|||...:||| |.::..|.|.|..||
Human   351 GGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFE 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 33/90 (37%)
DUF3518 2191..2451 CDD:288854
ARID4BNP_001193723.1 TUDOR 58..113 CDD:197660
RBB1NT 170..262 CDD:285392 20/113 (18%)
ARID 311..394 CDD:198082 30/83 (36%)
Antigenic epitope 465..473
Tudor-knot 571..624 CDD:288553
Antigenic epitope 1130..1137
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.