DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and Arid3b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_008764545.1 Gene:Arid3b RGDID:1306335 Length:573 Species:Rattus norvegicus

Alignment Length:472 Identity:122/473 (26%)
Similarity:165/473 (35%) Gaps:140/473 (30%)


  Fly   803 PGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQDNGISSSG 867
            ||.|.|.| .:||........|......||.:  ..:|:       .|.||.|....|:.     
  Rat    50 PGRPSGSP-VLGPLGRVLPATPAARVSEQSNV--NSEPE-------EEEGGLEDEDGDDD----- 99

  Fly   868 PTGAAGMHAVTSVVTTGPDGTS----MDEVSQQ----STLSNASAASGEDPQCTTPKSRKNDPYS 924
                     ||.|........|    |.:.::|    :.:|:...|.|..||..|    |.|...
  Rat   100 ---------VTEVAEKEAQAASKYFHMQKATRQEPRAAPMSSLLPAPGLPPQGQT----KEDHTK 151

  Fly   925 QSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKK-- 987
            .:..||||.        |..|         .|:|.......|            |.|:...|.  
  Rat   152 DASKAPPSV--------PTAG---------QPSWNLDEQLKQ------------RKTLLGQKNGA 187

  Fly   988 ---------------SDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRL 1037
                           |....||||:|.:|:|:.:||.|..||::|.|||...|.::||.||||.|
  Rat   188 LAWSDDADGGRGREISRDFAKLYELDGDPERKEFLDDLFIFMQKRGTPINRIPIMAKQILDLYML 252

  Fly  1038 YIYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYTKNLLTFECHFDRGDIDPLPII 1101
            |..|.|:||.||:...|.|::|...|.:..| :|||:|||..|.|.|..:||.            
  Rat   253 YKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYAYECE------------ 305

  Fly  1102 QQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSP 1166
                       .||.|.|:.....:|.........|.|...|...|.:|..||            
  Rat   306 -----------KKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAAAAAA------------ 347

  Fly  1167 YPVASGPQPDYATAG--QMQRPP------------SQNNPQTPHPGAAAAVAAGDNISVSNP--- 1214
               |:......|:||  .:..||            |..|..:|....|:.:..||.:.|..|   
  Rat   348 ---AAAAAASAASAGAPALLSPPKIRFSILGLGSSSGTNTSSPRIPPASTLRKGDGVPVPVPNRL 409

  Fly  1215 -FEDPIAAGGGPGSGTG 1230
             ...|: ||...|:.||
  Rat   410 AVSGPL-AGQQAGNRTG 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 42/92 (46%)
DUF3518 2191..2451 CDD:288854
Arid3bXP_008764545.1 BRIGHT 216..305 CDD:128777 42/89 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.