DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and htk

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster

Alignment Length:2387 Identity:447/2388 (19%)
Similarity:662/2388 (28%) Gaps:849/2388 (36%)


  Fly   212 TPTLNSLLQSSNPPPPPQHRYANTYDPQQAAASAAAAAAAQQQQAGGPPPPGHGPPPPQHQPSPY 276
            |.|::.|.|      |.|.....:.....||||.||::.                          
  Fly   424 TETISKLAQ------PNQTNVVASTSSSAAAASVAASST-------------------------- 456

  Fly   277 GGQQGGWAPPPRPYSPQLGPSQQYRTPPPTNTSRGQSPYPPAHGQNSGSYPSSPQQQQQQQQQQQ 341
                     |.|..|    .:.|.......|||.......|...|..||..||.|.:.:...::.
  Fly   457 ---------PARAVS----TASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKY 508

  Fly   342 QQAGQQPGGPVPGGPPPGTGQQPPQQNTPPTSQYSPYPQRYPTPPGLPAGGSNHRTAYSTHQYPE 406
            ::              ..|..|.....|...|..|......||.....:..:|..:|.|      
  Fly   509 EE--------------KSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATS------ 553

  Fly   407 PNRPWPGGS--------SPSPGSGHPL--------PPASPHHVPPLQQQPPPPPHVSAGGPPPSS 455
                  |||        :....|..||        ..||..|  .::::    .::|:|....:|
  Fly   554 ------GGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRH--SMEKE----TNISSGSSASAS 606

  Fly   456 SPGHAP----SPSPQPSQASPSPHQELIGQNSNDSSSGGAHSGMGSGPPGTPNPQQVM------- 509
            |..::.    |....||.|:|             .|:|.:.||..:......|.::..       
  Fly   607 SKANSAEMQRSRDASPSVAAP-------------PSAGASTSGAAATAQTASNKKEKHQRSKQAD 658

  Fly   510 ----RPTPSPTGSSGSRSMSPAVAQN------------------HPISRPASNQSSSGGPMQQPP 552
                :.......|||.|.......:.                  |....|:|:.|:....:.:..
  Fly   659 KEKDKDKEEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEIS 723

  Fly   553 VGAGGPPPMPPHPG-----------------MPGGPPQQQQSQQQQASNSASSASNSPQQTPPPA 600
            |..|.|..:..:.|                 :..|..|:.::....::||.|...          
  Fly   724 VQRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGG---------- 778

  Fly   601 PPPNQGMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYPPR 665
                              |..|||        ||...||.|.|...||..|.......||.....
  Fly   779 ------------------GGGGGG--------GGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCS 817

  Fly   666 PQYPPGAYATGPPPPPTSQAGAGGANSMPS------------GAQAGGYPGRGMPNHTGQYPPYQ 718
            ...|....:|||..|..| ...|||:|.||            ||:.|......||          
  Fly   818 KMSPSSGNSTGPGAPSLS-GSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMP---------- 871

  Fly   719 WVPPSPQQTVPGG---------APGGAMVGNHVQGKGTPPPPVVGGPPP----------PQGSGS 764
                 |:.|.|..         :|..:......|.|..|...|.|...|          ...|.|
  Fly   872 -----PRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDS 931

  Fly   765 PRPLNYLKQHLQHKGGYGGSPTPPQGPQGYGNGPTGMHPGMPMGPPHHMGPPHGPTNMGPPTSTP 829
            ..|:...|:.........|...||      |.|.............|    |...:........|
  Fly   932 DEPVRRPKRQSAKDKPQAGKAQPP------GKGRLASSASSTAPAAH----PSDDSEEDEEEEEP 986

  Fly   830 PQSQMLQGGQPQGQGAS-GGPESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEV 893
            ..::.....|.|.|.:| .|..:||       |...|||...|.|.....|.:.:...|      
  Fly   987 SAARAASSKQQQQQASSLRGSRAGG-------NRAMSSGAASAKGRDYDLSEIRSELKG------ 1038

  Fly   894 SQQSTLSNASAASGEDPQCTTPKSRKNDP------------------------YSQSHLAPPSTS 934
            .|...|:|  |||.|:.:....|...::|                        .::|:....|.|
  Fly  1039 FQPKLLTN--AASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETESYADEDSQS 1101

  Fly   935 PHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVP-------VPQEPFR-STITTTKKSDSL 991
            ........|.|.|::          .|..||...:|.|       |.:||.: ...|..|:.::.
  Fly  1102 SDYRKQLKGSGAGKK----------EPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETK 1156

  Fly   992 CKLYEMDDN--------PDRRGWLDKLRAFMEERRTPITACPT--ISKQPLDLYRLYIYVKERGG 1046
            .|.:....:        |.|.|.....:|......:..||..|  |.::||.:          ||
  Fly  1157 SKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTI----------GG 1211

  Fly  1047 ----------FVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPII 1101
                      ..|:.|    |...|..|..||||||....|.:.:                 |: 
  Fly  1212 KKSVEQHVPKKAELLK----KQSGGAGGTAASSSAASQESKKFAE-----------------PV- 1254

  Fly  1102 QQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSP 1166
                 .|.|....||..||              .||:|..|| ...|||.::: ......|..|.
  Fly  1255 -----ASLKVEMPAACSPS--------------SSSSSSSSF-CSTGSAVSSS-SATRSLPDMSK 1298

  Fly  1167 YPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAA--------AAVAAGDNISV------------ 1211
            ..::||..|. ||.|.....|| |..|....|||        ...|||..||:            
  Fly  1299 LEISSGTVPG-ATPGAAALQPS-NVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEFK 1361

  Fly  1212 -SNPFE-----DPIAAGGGPGSGTGPGPGQGPGPGAAS--------GGAGAVGAVGGGPQPHPPP 1262
             :.|||     .|:|:.||..:......|.....||||        .||...|.........|..
  Fly  1362 DTEPFEFEKRISPMASVGGTVAAAATAAGAMAAAGAASVITTMVPTPGASGSGVAASASTSAPVV 1426

  Fly  1263 PHSPHTAAQQAAGQHQQQH-PQHQHP-------GLPG--------PPPPQQQQG----------- 1300
            ..|  .|.:||......|| .:||.|       |..|        ..|..:::|           
  Fly  1427 VGS--AARKQALKASAIQHILEHQSPAAGRERGGYGGMTSSISLLTAPKLKKRGSPLKEAALCME 1489

  Fly  1301 ---------QQGQQPPPSVGGGPPPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRT 1356
                     .|.|||                   |....||.::|..| |....|:|.|..:|..
  Fly  1490 KAKTYKLDKDQVQQP-------------------VEQKTQQLIQPTLG-PVESYGAGSPEAMSNL 1534

  Fly  1357 PGSPYPSQPGAYGQYGSSDQY-------------------------------------------N 1378
               ..|:....:.|..:|..|                                           :
  Fly  1535 ---STPTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQETTRALTD 1596

  Fly  1379 ATGPPGQPF-------GQGPGQYPPQNRNMYPPYGPEG----EAPPTGANQYGPYGSRPYSQPPP 1432
            |..||..|.       |..|....|....| |..|..|    ..||||||   |..:.|....||
  Fly  1597 ALQPPSTPVPPTVSASGSTPTAVTPVITAM-PTAGTAGLSCPSTPPTGAN---PVLASPKLSTPP 1657

  Fly  1433 ----GGPQPPTQTVAGGP----------------------------------------------- 1446
                ...|||...:.|.|                                               
  Fly  1658 QAINASKQPPASHIVGSPFIETRNVFELSTSNEGSGYSSGESKDNKFEKLENVKILLAGAVGPFD 1722

  Fly  1447 -PAG----------------------------GAPGAPPSSAYPT-GR----------------- 1464
             .||                            |.|...|::|..| ||                 
  Fly  1723 LDAGSYEQKTSSIADKVLKAISQKKEEVENNKGKPPVEPAAAAKTPGREDVVPSPTAKLDLCSSA 1787

  Fly  1465 ------------------PSQQDYYQP-PPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSG 1510
                              |...:.|:| |...||:.:   ..::.|.|.........|.....:.
  Fly  1788 IKLDTLKLLSEPLKIQTGPLLGELYRPGPATSSPETK---SILESSLPAKNSELSETIQKLECAI 1849

  Fly  1511 TQQYRPQYPSSPAPQNWGGAPPRGAAPPPGAPHGPPIQQPAGVAQ------------------WD 1557
            .|:..|...:.....:..|.||....|...|..|      ||.:.                  .:
  Fly  1850 QQRKTPVGGALSLASSTAGTPPTAHTPNSTATAG------AGFSDESMDSTDSEQRLVIEDVIAE 1908

  Fly  1558 QHRYPPQQGPPPPPQQQQQPQQQQQQPPYQQVA----GPPGQQPPQAPPQWAQMNPGQTAQSGIA 1618
            :|......|....|..||:..|.........|.    |.....|....|...::..|..|..||.
  Fly  1909 EHTTTTTTGEQKSPGSQQEEGQTNTATMATAVTAETEGTSSSTPTPPVPAPVKLELGAKAMPGIQ 1973

  Fly  1619 PPGSPLRPPSGPGQQNRMPGM----PAQQQQSQQQGGVPQPPPQQASHGGVP------------- 1666
            .| .||:|..|.....::.|:    |..:.|.|::.|..|...:..|..|:|             
  Fly  1974 AP-IPLKPAEGSSFAGKLTGVVQPPPLAKLQQQEELGQAQGQSKSISSFGIPIVLPEIPASVVVA 2037

  Fly  1667 ---------------SPG------------------LPQVGP-GGMVKPPYAMPPPPSQGVGQQV 1697
                           |||                  .|:||. ||::...|.       ||...|
  Fly  2038 TPALMVASAATVMRHSPGSTPNSQAPVLISPKTFLTAPKVGEVGGLLLKAYT-------GVSGAV 2095

  Fly  1698 GQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQM--PPNQTAPGGYGPP 1760
            |..|.|.:::..........:...|.|||..|...........:....:|  |.|.:||....|.
  Fly  2096 GAAPAGSVIASAGGGGTPTVISNFPQQQQQASVLQASSEMPANYVLDAEMAEPSNSSAPVVARPF 2160

  Fly  1761 GMPGGGAQL-------VKKELIF-PHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRSGLLT 1817
            .|...|.:|       ....||. ||:  ||.        .|:..:..|..|     |...|...
  Fly  2161 VMHAVGKELFNVVAPAASSPLISDPHN--ESI--------NLLCEETIPGSP-----APNYGGTD 2210

  Fly  1818 ECTWALDVLNVLLFDDSTVQFFGISNL-----PGLLTLLLEHFQKNLAEMFDERE---------- 1867
            :...|:         :|.:...||:.|     |.:....::..|::..:...:::          
  Fly  2211 QLPTAV---------NSALAIVGITPLPPDTPPPVPVAAIQQQQQHQLQSGQQQQAAKTGEVNPS 2266

  Fly  1868 --NEEQSALLAEDADDDA---------DSGTVMCEKLRTSGRQP-----RCVRSISSY-----NR 1911
              |....:...:::.::|         ||..:.....|...|:|     :...::::.     .|
  Fly  2267 GPNSSPDSASQDESGEEAKKNAGLEHEDSTGLGALNKRKRNRKPLPMSAQTAAAVAAQLQSLGKR 2331

  Fly  1912 RRHYENMDRSGKDGAGNGSDSEDADEGI--DLGQVRVQPNPEERSLLLSFTPNYTMVTRKGVPVR 1974
            ||....|..........|||::|..:.|  :.||.:.||....|..::                 
  Fly  2332 RRQVSGMRNQKTTTTAAGSDTDDNSDNIAPNAGQQQQQPRQSARQHMM----------------- 2379

  Fly  1975 IQPAENDIFVDERQKAWDIDTNRLYEQLEPVGSDA---WTYGF-TEPDPL---DGIIDVFKSEIV 2032
               .:::....::|:.......:|.:.::...|..   ..|.| .|.||.   |..|.:.:.:|.
  Fly  2380 ---PQSNAQQQQQQQLLQQQQTQLPQGIQSTNSSGVRPCPYNFLVELDPALSSDECITILRKQIQ 2441

  Fly  2033 NIPFARYIRSDKKGRKRTELA-SSSRKPEIKTEENSTEEQTFNKKRR 2078
            ::   |...:..||    ||| ...|:.:::..|...::|....:::
  Fly  2442 DL---RKAYNTIKG----ELAVIDRRRKKLRRREREKKQQQLQSQQQ 2481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 24/103 (23%)
DUF3518 2191..2451 CDD:288854
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 8/59 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
11.030

Return to query results.
Submit another query.