DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and sol1

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_595529.1 Gene:sol1 PomBaseID:SPBC30B4.04c Length:865 Species:Schizosaccharomyces pombe

Alignment Length:1212 Identity:231/1213 (19%)
Similarity:339/1213 (28%) Gaps:517/1213 (43%)


  Fly  1347 SGYPTPVSRTPGSPYPSQPGAYGQYGSSDQYNATGPPGQPFGQGPGQYPPQ--NRNMYPPYGPEG 1409
            |.|||.||      ||:|..:|........|      .|.|....|.|..:  |.||.       
pombe    10 SDYPTAVS------YPTQGQSYNTQEEQPAY------PQRFSTSQGMYAAEYGNANMM------- 55

  Fly  1410 EAPPTGANQYGPYGSRPYSQPPPGGPQPPTQTVAGGPPAGGAPGAPPSSAYPTGRPSQQDYYQPP 1474
               .|..|:                                          |......|.:.|.|
pombe    56 ---NTSENE------------------------------------------PNNLAHSQPFRQSP 75

  Fly  1475 PDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQ-SGTQQY-RPQYPSSPAPQNWGGAPPRGAAP 1537
            ..|...|.:..||..:              |||. ||:.:| .|..|||                
pombe    76 STQRNLPNQSFDFASN--------------GAWNGSGSVKYSSPMMPSS---------------- 110

  Fly  1538 PPGAPHGPPIQQPAGVAQWDQHRYPPQQGPPPPPQQQQQPQQQQ---------------QQPPYQ 1587
                                  |.|.||......|||||.||||               ||.|..
pombe   111 ----------------------RIPFQQEKEAAMQQQQQQQQQQQLYQRQMQSREALLSQQIPPN 153

  Fly  1588 QV---AGPPGQQPPQAPP-------QWAQMNPGQTAQ---------SGIAPPGSPLRPPSGPGQQ 1633
            |:   |.|..:|.||..|       ...|:.|...|.         |.:...|:|::  |.| |.
pombe   154 QIGINAHPAVRQTPQPAPSPNTPSGNANQLTPAYAASFDKFMVSLISFMEKRGTPIK--SYP-QI 215

  Fly  1634 NRMP--------------------------------GMPA------------------------- 1641
            |..|                                |.|:                         
pombe   216 NNTPINLMMLYALVMRAGGSRQVSAHNFWPKISASLGFPSPDAISLLIQYYNSYLLPYEEAWLAA 280

  Fly  1642 -QQQQSQQQG-------------GVPQPPPQ---QASHGGVPSPGLPQVGPGGMVKPPYAMPPPP 1689
             |||:|.||.             ..||.|.|   :|.|..           |.|....::..|.|
pombe   281 QQQQKSLQQAKANHSANVQSRPKNYPQKPVQTTPEAVHAN-----------GSMHGSLHSKSPSP 334

  Fly  1690 SQGVGQQVGQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQMPPNQTAP 1754
            :....:.....|......:..||.|     ..|.:..||:.|          ......|.:...|
pombe   335 AFTANRFSPAAPTTVSSERNAPPYP-----SAPTRPTPPTVQ----------TSSSAAPVDSAEP 384

  Fly  1755 GGYGPPGMPGGGAQLVKKELIFPHDSVESTTPV---LYRRKRLMKADVCPVDPWRIFMAMRSGLL 1816
            ..|.|...|      :...|.:|. :|.:|..:   |.|.:.....|:..|:...:.|:::|.|.
pombe   385 VAYQPIKKP------IDPMLGYPL-NVAATYRLDESLLRLQMPSIVDLGTVNIQALCMSLQSTLE 442

  Fly  1817 TECTWALDVLNVLLFDDSTVQFFGISNLPGLLTLLLEHFQKNLAEMFDERENEEQSALLAEDADD 1881
            .|.|:|::||.:|..|...:  |.:|....::..|::...:.|..:.....||:    |.|.||.
pombe   443 KEITYAMNVLLILTNDQKWM--FPLSECQDVVDALIDVATQCLDNLLSVLPNED----LMEIADK 501

  Fly  1882 DADSGTVMCEKLRTSGRQ--PRCVRSISSYNRRRHYENMDRSGKDGAGNGSDSEDADEGIDLGQV 1944
                        |.|.||  ..|...||.::|    |:...|..:     :.::|:...||:   
pombe   502 ------------RPSYRQLLYNCCVEISQFSR----EDFSNSLSE-----NKTKDSINAIDV--- 542

  Fly  1945 RVQPNPEERSLLLSFTPNYTMVTRKGVPVRIQPAENDIFVDERQKAWDIDTNRLYEQLEPVGSDA 2009
                :..|::||..|.                     ||  .....::.:.|.|.:         
pombe   543 ----HNSEQNLLAVFV---------------------IF--RNLSHFEANQNVLVQ--------- 571

  Fly  2010 WTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKKGRKRTELASSSRKPEIKTEENSTEEQTFN 2074
                  .||....:|.|.||  :|.             ..|.|..|||                 
pombe   572 ------NPDFFPLLIRVVKS--LNF-------------HATSLLRSSR----------------- 598

  Fly  2075 KKRRLVSGGSSSSGAHAEGKKSKL-----TSEEFAQPNAEV---------------KKEPGTADS 2119
                      ::...|    |..|     .|:.|..||.:|               :|:..|..:
pombe   599 ----------NTLDLH----KDVLIVLCQLSQNFILPNVDVARHVLLFILSFSPFNRKKSKTILN 649

  Fly  2120 DCRPVDMD-------------IEAPQQRLTNGVAPCSSTPAIFDPRTTAKDEARVLQRRRDSSFE 2171
            |..|..:.             |.|..:.|.......::..||||......|...:|.......|.
pombe   650 DTLPTSIPSYTPATHPYAGPAINAYAKLLAKDANNKTNFQAIFDNNPKFLDSLFLLLASVVPKFN 714

  Fly  2172 DECYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEH 2236
            ..|....|..|.|:.:|...||                   .||                   .:
pombe   715 RHCLKICERRLPLLQQSFFCLA-------------------ATV-------------------SY 741

  Fly  2237 LRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIAR 2301
            ::::.:..|:           |:               |.|...|:|..:           ||  
pombe   742 VKQSEQAANW-----------CN---------------IGEGFFVSMLRL-----------LI-- 767

  Fly  2302 PLIDGLLHWAVCPSAHGQDPFPSCGP-----NSVLSPQRLALEALCKLCVTDANVDLVIATPPFS 2361
             |:.|  |.::.|.:.....:|:..|     .|.:|..|..|.     .|...|:.|    ..|.
pombe   768 -LLSG--HPSLNPPSRVASQYPTTNPFRYVIQSGISTVRRLLS-----LVEAGNISL----SSFP 820

  Fly  2362 RLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMART 2403
            :.|.|.|||...  ..|...|:|.| |||.....:|:::..|
pombe   821 KSETLLAVLLAP--TTETSFLKEIS-NLLDRTGDSDASLENT 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777
DUF3518 2191..2451 CDD:288854 40/219 (18%)
sol1NP_595529.1 BRIGHT 189..277 CDD:128777 11/91 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.