DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and Arid5a

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_001277655.1 Gene:Arid5a MGIID:2443039 Length:619 Species:Mus musculus

Alignment Length:679 Identity:151/680 (22%)
Similarity:214/680 (31%) Gaps:230/680 (34%)


  Fly   924 SQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKS 988
            ::...|||:..        .....||.|:...|..|:|            ..|..||...|    
Mouse    27 AEHQTAPPAKG--------NTEQSEEGDLPQLPVSPKP------------DDEQSRSQSPT---- 67

  Fly   989 DSLCKLYEMDDNPDRRG-------WLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGG 1046
                   ::.|:|:..|       :|..|..||:||.|||...|.:..:.::|:::|..|::.|.
Mouse    68 -------QLQDSPEAGGEQEEEQAFLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGA 125

  Fly  1047 FVEVTKSKTWKDIAGLLGIGA--SSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQ------- 1102
            :..||..:.||::...|| |:  |:|||...|:||.:.:|.:..|....|..|||..:       
Mouse   126 YELVTGRRLWKNVYDELG-GSPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPPTKPRKQYKM 189

  Fly  1103 ----QVEAGSKKKTAKA-------ASVPSPGGGHLDA-GTTNSTGSSNSQDSF--------PAPP 1147
                :.:.|:.:|..||       ....:||....|| |.|......:|:||.        |:||
Mouse   190 AKELRGDDGTTEKLKKAKDSEERRVEQTTPGKTKSDATGQTQLPCQGSSRDSTEQLGPVSGPSPP 254

  Fly  1148 GSAPNAAIDGYPG-----YPGG-----SPYPV-----------------------ASGPQPDYAT 1179
            .:..::..:.|..     |..|     ||...                       |..|..|...
Mouse   255 LTGASSCPEAYKRLLSSFYCKGAHGIMSPLAKKKLLAQVSKAEALQCQEEGCRHGARSPNKDIQD 319

  Fly  1180 AGQMQRPPSQNNPQ--TPHPGAAAAVAAGDNISVSNPFEDPIAAGGGPGSGTGPGPGQGPGPGAA 1242
            :.|..|.|::|:..  ||..|..|                       ||..|......||.|.|.
Mouse   320 SPQNLRGPAENSEHQLTPREGLQA-----------------------PGGSTRMEAQVGPCPTAP 361

  Fly  1243 SGGAGAVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQHQHPGLP-----GPPPPQQQQGQQ 1302
                    ...|....:|.....|           ..|||:....||.     |||         
Mouse   362 --------MFSGCFHAYPTEVLKP-----------VSQHPRDFFSGLKDRVLLGPP--------- 398

  Fly  1303 GQQPPPS------VGGGPPPAPQQHGPGQVP-----PSPQQ-HVRPAAGAPYPPGGSGYPTPVSR 1355
            |::..|:      |.||....|.....|...     |.|:. .|.|.|..|            :.
Mouse   399 GKEEGPTTKESHLVWGGDANHPSAFHKGSTRKRSFYPKPKACWVSPMAKVP------------TE 451

  Fly  1356 TPG--SPYPSQPGAYGQYG---------------------SSDQYNATGPPGQP-------FGQG 1390
            .||  ||:||.||...:.|                     ..|.....|.|..|       .|..
Mouse   452 RPGAPSPHPSSPGLGSKRGLEEEGFAHGGKKLRAVSPFLKEVDSKETGGKPAAPGLAVSCLLGPT 516

  Fly  1391 PGQYPPQ---NRNMYPPYGPEGEAPPTGANQYGPYGSRPYSQPP---PGGPQPPTQTVAGGPPAG 1449
            ||..||:   ...:..|....|.|.|....     .|.|:|  |   |..|.....|....|.|.
Mouse   517 PGPTPPEAYRGTMLRCPLNFTGSADPLKGQ-----ASLPFS--PLVIPAFPAHLLATTGSSPMAA 574

  Fly  1450 GAPGAPPS--SAYPTGR--PSQQDYYQPP 1474
            .....||:  .|....|  |:...::.||
Mouse   575 SLMHFPPTPYDAVLRNRLGPASSAWHMPP 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 32/100 (32%)
DUF3518 2191..2451 CDD:288854
Arid5aNP_001277655.1 BRIGHT 85..172 CDD:128777 30/88 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.