DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and ARID3C

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_016869772.1 Gene:ARID3C HGNCID:21209 Length:562 Species:Homo sapiens

Alignment Length:856 Identity:182/857 (21%)
Similarity:253/857 (30%) Gaps:371/857 (43%)


  Fly   599 PAPPPNQ---GMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGP-----------GQSPGAQGY 649
            |:..|..   .:.::|:|...|..|.  ..|:||.: .|.|:|..           |.||.|   
Human     2 PSVTPTDTCCSLTHLASPHSVPLFAF--QRPLPPKL-AGKKVGDTCWGAESGRSHRGLSPCA--- 60

  Fly   650 PPQQPQQYPPGNYPPRPQYPPGAYATGPPPPPTSQAGAGGANSMPSGAQAGGYPGRGMPNHTGQY 714
            ||..|:..|          .|.|.|:......|:..||.|..|.|.|      |.||        
Human    61 PPALPRSGP----------APAAAASSAASERTAARGAQGGGSAPPG------PSRG-------- 101

  Fly   715 PPYQWVPPSPQQTVPGGAPGGAMV------GNHVQGKGTPPPPVVGGPPPPQGSGSPRPLNYLKQ 773
                      |..:.||...|:.|      |:..|...:....:|.|.|   .:|..| |..:.:
Human   102 ----------QGRLGGGRSKGSAVETPGAAGHARQAALSSGSRLVPGTP---SAGGLR-LEAVME 152

  Fly   774 HLQHKGGYGGSPTPPQGPQ-GYGNGPTGMHPGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQG 837
            .||.:          |..: ..|.||  :.|..|:.||.            ||.   |..:.|| 
Human   153 ALQKQ----------QAARLAQGVGP--LAPACPLLPPQ------------PPL---PDHRTLQ- 189

  Fly   838 GQPQGQGASGGPESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNA 902
                                         .|.||.|     :|.....:....||..::...:..
Human   190 -----------------------------APEGALG-----NVGAEEEEDAEEDEEKREEAGAEE 220

  Fly   903 SAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQV 967
            .||....|....|.|    |.||    ||...||                    .|         
Human   221 EAAEESRPGAQGPSS----PSSQ----PPGLHPH--------------------EW--------- 248

  Fly   968 FNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPL 1032
                 ..:|.|:             :|||:|.:|.|:.:||.|.:||::|.||:...|.::||.|
Human   249 -----TYEEQFK-------------QLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQVL 295

  Fly  1033 DLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYTKNLLTFECHFDRGDID 1096
            |||.|:..|..:||.|||...|.|:::...|.:..: :|||:|||..|.|.|..:||.       
Human   296 DLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECE------- 353

  Fly  1097 PLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPP-----GSAPNAAID 1156
                            .:|.|.|    |.|.| ..:|......:.::.|.|     |..|..|.|
Human   354 ----------------TRALSSP----GELQA-AIDSNRREGRRQAYTATPLFGLAGPPPRGAQD 397

  Fly  1157 GYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAAAAVAAGDNISVSNPFEDPIAA 1221
                 |...|     ||.|                                              
Human   398 -----PALGP-----GPAP---------------------------------------------- 406

  Fly  1222 GGGPGSGTGPGPGQGPGPGAASGGAGAVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQHQH 1286
               |.:.:.|||.||...|.                    |.|        |..|......:.:.
Human   407 ---PATQSSPGPAQGSTSGL--------------------PAH--------ACAQLSPSPIKKEE 440

  Fly  1287 PGLPGP--------------------PPPQQQQGQQGQQPPPSVGGGPPPAPQQHGP-GQVPPSP 1330
            .|:|.|                    .||:::....|...||.     |..|....| |:||...
Human   441 SGIPNPCLALPVGLALGPTREKLAPEEPPEKRAVLMGPMDPPR-----PCMPPSFLPRGKVPLRE 500

  Fly  1331 QQHVRPAAGAPYPPGGSG-----------------------YPTPVSRTPGSPYPSQPGAYGQYG 1372
            ::     ...|....|||                       .|.|.|:.|.:|.|..        
Human   501 ER-----LDGPLNLAGSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPP-------- 552

  Fly  1373 SSDQYNATGPP 1383
                  :||||
Human   553 ------STGPP 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 38/92 (41%)
DUF3518 2191..2451 CDD:288854
ARID3CXP_016869772.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
21.990

Return to query results.
Submit another query.