DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and arid5b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_017214107.1 Gene:arid5b ZFINID:ZDB-GENE-121214-272 Length:1079 Species:Danio rerio

Alignment Length:967 Identity:192/968 (20%)
Similarity:294/968 (30%) Gaps:305/968 (32%)


  Fly   971 VPVPQEPFRSTITTTKKSDSLCKLYEMDDNP----------DRRGWLDKLRAFMEERRTPITACP 1025
            |..|:.|          |...||..:.::.|          |.:.:|..|..:|:||:|||...|
Zfish   218 VSKPRNP----------STGSCKRVQSENKPKGDGGDECRTDEQAFLVALYKYMKERKTPIERIP 272

  Fly  1026 TISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIG-ASSSAAYTLRKHYTKNLLTFECH 1089
            .:..:.::|:.::...::.||:..:|..:.||::...||.. .|:|||...|:||.:.:|.:| .
Zfish   273 YLGFKQINLWTMFQAAQKLGGYEVITARRQWKNVYDELGGNPGSTSAATCTRRHYERLILPYE-R 336

  Fly  1090 FDRGDID-PLPII--QQVEAGSKKKTAKAASVP---------SPGGGH------LDAGTTNSTGS 1136
            |.:|:.| |||..  ::.|...::...||..:|         :|.|..      |:.|..:....
Zfish   337 FTKGEEDKPLPPAKPRKQEGSVQESIIKAKMMPIKRPKDEQKTPRGDKDASAKVLELGMEDMEEL 401

  Fly  1137 SNSQDS--FPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGA 1199
            ...|:|  ..||.                                  |..|.|  |:|.|.....
Zfish   402 QEKQNSQQLQAPT----------------------------------QTDRDP--NSPLTEDDEG 430

  Fly  1200 AAAVAAGDNISVSNPFEDPIAAGGG--PGSGTGPGPGQGPGPGAASGGAGAVGAVGGGPQPHPPP 1262
            ...:...|...:.|.:|.   |.||  |..     |..|....:....|..|.||   |..|..|
Zfish   431 VLVIKDEDQPVLHNAYEH---ANGGLLPSL-----PQDGAQLKSEDCDAFPVAAV---PLHHGHP 484

  Fly  1263 PHSPHTAAQQAAGQHQQQHPQHQHPGLPGPPPP------QQQQGQQGQQPPPSVGGGPPPAPQQH 1321
            ..:.||:            .|.:|..|....||      :|.:.::||.....|    .|..||.
Zfish   485 LPNSHTS------------DQWKHGILEYKVPPSALANVEQSRPKEGQNQVVMV----LPTLQQK 533

  Fly  1322 GPGQVPPSPQQHVRPAAGAP---------YPPGGSGYPTPVSRTPGSPYPSQPGAYGQYGSSDQY 1377
             |...|..|.:.|.|.....         ||.|..|..:|:::.......|..|....|      
Zfish   534 -PVTSPEIPPERVEPLKKEESCFNFNPLLYPRGNPGIMSPLAKKKMLSQVSGTGLLNNY------ 591

  Fly  1378 NATGPPGQPFGQGPGQYPPQNRNMYPPYGPEGEAPPTGANQYG-------------------PYG 1423
             ..|||           ||.........|.|..:....::|..                   .:.
Zfish   592 -PYGPP-----------PPLVSRRLSSSGTEVSSAGQSSSQVSSSVETSIVIKRPSVIQHAQSFK 644

  Fly  1424 SRPYSQPPPGGPQPPTQTVAGGPPAGGAPGAPPSSAYPTGRPSQQDYYQPPPD-----QSPQPRR 1483
            ||        |.:....:..|....|.:.|.|...:....|........|...     :.|:|.:
Zfish   645 SR--------GSEDRRSSTEGSQKDGCSEGEPVHHSQTLIREPYLKRVDPHSSMEKSAEMPRPGQ 701

  Fly  1484 HPDFIKD--SQPYPGYNARPQIYGAWQSGTQQYRPQ------------YPSSPAPQNWG------ 1528
            .|.|:.:  |.|:.....|...:...:....:|..:            :|.|..|.|.|      
Zfish   702 APSFLSEFYSSPHLHNLCRQTEHHLSKEQISKYLSRDVYTRDSETAQGFPPSQHPDNVGLNFSAR 766

  Fly  1529 ------GAPP-RGAAPPP---------------------GAPHGPPIQQ--------PAGVAQWD 1557
                  |.|| |.....|                     |.||. .|||        .||.:|..
Zfish   767 LSQKEKGPPPERVTEEQPTDLSLPKSSPLKLPLSTSTLGGIPHA-AIQQDIKNSPHFQAGNSQSS 830

  Fly  1558 QHRYPPQQGPPPP--------------------PQQQQQPQ-----QQQQQPPYQQVAGPPG--- 1594
            ...|.|:....||                    |..:.:..     .:..:|.....:.|..   
Zfish   831 SVDYHPRACRVPPMTVSASKKVTESHSKVLEKTPNSRGEESMGFKIDEMSRPILSTKSSPQNICT 895

  Fly  1595 QQPPQAPPQWAQMNPGQTAQSGIAP---------PGSPLRPPSGPGQQNRMPGMPAQQQQSQQQG 1650
            .:|.:...:..:..|.:.....:.|         ||.|..|.:  ..::..|..||....|....
Zfish   896 ARPLKRNIEDLENGPTEKKIRAVTPLHCSTQRDLPGKPRTPEA--DSESVKPAEPAVHINSYTSE 958

  Fly  1651 GVPQPPPQQASHGGVPSPGLPQV-----GPGGMVKPPYAMPPPPSQGVGQQVGQGPPGGMMSQKP 1710
            |...|.......|..|...:.||     ..|..|.|.|:   .|.|.:..|       .::|   
Zfish   959 GHKIPLHSHLFQGLYPGTFVSQVQDMCESLGSHVTPSYS---HPLQYLKNQ-------AVLS--- 1010

  Fly  1711 PPMPGQAMQQQPLQQQ----PPSHQHP-----------HPHQHPQ---HQHPHQMPP 1749
            |.||..|:....:|:|    .|:|.:.           ||..:|.   |..|...||
Zfish  1011 PLMPPFAIHSLMMQRQFLAANPAHMYRHQVGTSYGDILHPGLYPMSALHPQPAFSPP 1067

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 29/102 (28%)
DUF3518 2191..2451 CDD:288854
arid5bXP_017214107.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.