DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and arid1b

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_004914686.1 Gene:arid1b XenbaseID:XB-GENE-1010354 Length:2413 Species:Xenopus tropicalis

Alignment Length:2808 Identity:745/2809 (27%)
Similarity:1031/2809 (37%) Gaps:846/2809 (30%)


  Fly    46 NNNSNNGSDPSIQQQQQN--VAPHPY------GAP--PPPGSGPGGPPGPDPAAVMH-----YHH 95
            |.|:||.|..:..::.:|  |:||.:      |.|  ...|||.....|...|.:.|     :||
 Frog   102 NTNNNNSSSDAGHKEGRNSAVSPHYHVVDMGGGVPNHKLKGSGSSASGGDYLAPITHPLHPPHHH 166

  Fly    96 LHQQQQQHPPPPHMQQQQHHGGPAPPPPGGAPEHAPGVKEEYTHLPPPHPHPAYGRYHADPNMDP 160
            .| ..||||        .||          ||:|.    :::....|.||||........|....
 Frog   167 AH-HPQQHP--------SHH----------APQHL----QQHPPYHPNHPHPPQQLNQLQPQQLS 208

  Fly   161 YRYGQPLP------GGKPPQQQQPHPQQQPPQQP----GPGGS-------------------PNR 196
            ....||.|      ||...:......|||..||.    |..||                   |.|
 Frog   209 GTIQQPSPNKSSPGGGSSSEASDMENQQQQQQQQHGGVGEEGSNSAAAAGKDVALGNQGDSQPRR 273

  Fly   197 ------------------PPQQRY----IPGQPPQGPTPTLNSLL-----QSSNPPPPPQHRYAN 234
                              |...||    :.|........|.|:.:     .||:..........:
 Frog   274 ATKADEDDLQQGKMRVGEPVSGRYEHTVLGGGQGNSSNNTTNNNIGGSGGSSSSSSSSSSSSSVS 338

  Fly   235 TYDPQQAAASAAAAAA-----AQQQQAG------GPPPPGHGPPPPQ-------------HQPSP 275
            .::....:||.:.|..     .:||..|      |...|.....|.|             |....
 Frog   339 DFNNYYGSASTSRAGPCFDQHGRQQSPGMGMMHSGTAAPNSSMEPIQNSHEGFGSGSHYEHYQGS 403

  Fly   276 Y------GGQQGGWAPPPRPY----SPQL--------------GPSQQYRTPPPTNTS-----RG 311
            |      ||..|.:......|    ||:.              |.:...:.|..:|..     :|
 Frog   404 YSRAAAAGGGIGAYGSTAAGYGVLGSPRQSSSGTSSSSILMGGGGTSHGKAPSASNAGGFQRYQG 468

  Fly   312 QSPYP---------------PAHGQNSGSYP-----SSPQQQQQQQQQQQQQAG----------- 345
            |:|:|               |......||||     |.||||....|..||..|           
 Frog   469 QTPHPSGATPTLNQLLTSPSPMMRSYGGSYPDFGSSSGPQQQSGSSQGSQQPMGMGKDMGSQYGA 533

  Fly   346 -------QQPGGPVPGGPPPGTGQQP--PQQNTP--------------------PTSQYSPY--- 378
                   ||...|...  |..|||..  |||..|                    .|.|.|||   
 Frog   534 ANSAWGAQQRNHPAMS--PGSTGQNSNRPQQGGPMDPMTMKRPQLYGIGGAPYSQTQQSSPYPGQ 596

  Fly   379 ------PQRYPTPPGLPAGGSNHRT--AYSTHQYPEPNRPWPGGSSPSPG--------------- 420
                  |||||.       |...||  |....|||:...|...|.....|               
 Frog   597 AYGAPGPQRYPM-------GIQGRTQGAIVGMQYPQQQMPPQYGQQGVSGYCQQGQQPYYNQQSQ 654

  Fly   421 SGHPLPPASPHHVPPLQQQPPPPPHVSAGG-----PPPSSSPGHAPSPSPQ-PSQASPSPHQELI 479
            ..:|.|.|  .::...||:.||...|:..|     .|||.:||.:.:.... ..|..||...:|.
 Frog   655 PQYPQPQA--QYLSQAQQRYPPQQEVAQEGYGNRLQPPSVAPGKSNNEDMNLMQQERPSSLPDLS 717

  Fly   480 GQ------------NSNDSSSGGAHS-GMGSGPPGTPNPQQVMRPTPSPTGSSGSRSMSPAVAQN 531
            |.            :|..|:||...| |..|.|..:|.........||..|...|.|        
 Frog   718 GSIDDLPTGTEATLSSAVSASGSTSSQGEQSNPAQSPFSPHASPHLPSLQGGGPSPS-------- 774

  Fly   532 HPISRPASNQSSSGGPMQQPPVGAGGPPPMPP--------HPGMPGGPPQQQQSQQQQASNSASS 588
             |:..|..:..|..||:....:.....||.||        ||.:...|..|.:........:...
 Frog   775 -PVGSPVGSNQSRSGPISPASISGNQMPPQPPGSQSESSSHPALSQSPMPQDRGFISAVQRNNQI 838

  Fly   589 ASNSPQQTPPPAPPPNQGMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQ 653
            ....||.|.||          |:..||||.|          .||.|  ||...||..:..|..|.
 Frog   839 PQYGPQHTGPP----------MSPHPPPPGG----------QMHPG--MGSFPQSNSSGSYGSQM 881

  Fly   654 PQQYPPGNYPPRPQYPPGAYATGPPPPPTSQAGAG-----GANSM-----PSGAQA-GGYPGRGM 707
            .|..|.|||...|.|      ||  ...||.:|.|     .|||.     |||:.: |..||..|
 Frog   882 GQYGPQGNYSRSPSY------TG--VQNTSYSGPGPGINMNANSQIHGQGPSGSMSMGRMPGNAM 938

  Fly   708 PNHT-----GQYPPYQWVPPSPQQTVPGGAP-----------GGAMVGNHVQGKGTPPPPVVGGP 756
            .|.|     |..||..  ....||..||..|           ..|.|...........||.:..|
 Frog   939 QNRTYATNMGNLPPNS--SSMSQQGTPGMGPPMPTVNRKAQEAAAAVMQAAANSAQNRPPYIRSP 1001

  Fly   757 PPPQGSGSPRPLNYLKQHLQHKGGYGGSPTPPQGPQGYGNGPTGMHPGMPMGPPHHMGPPHGPTN 821
            ..|..||:                 ||.|........|||....|         .|....:|   
 Frog  1002 TYPSQSGA-----------------GGRPMFSSQHPNYGNAQVSM---------MHQTDQYG--- 1037

  Fly   822 MGPPTSTPPQSQMLQGGQPQGQGASG--GPESGGPEHISQDNGISSS---------GPTGAAGMH 875
                          |.|.| |...||  |..|...:.:|.::|:.:|         ..||..|: 
 Frog  1038 --------------QSGFP-GMNQSGLMGSNSAYNQSMSNNSGMMNSQQSPYNMMNSSTGHLGL- 1086

  Fly   876 AVTSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPY-SQSHLAPPS----TSP 935
              ..::.||       |....|||.....|....|    |:::..|.| ||.:..||:    |.|
 Frog  1087 --VDMINTG-------ESKMASTLKLDGKADSPAP----PETKSKDSYSSQGNSQPPTPGLLTVP 1138

  Fly   936 HPVVMHPGGGP-----GEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLY 995
            .|  :.|....     |:|.|..|.|.||:            .|..|..|:.|||  .:.:.|||
 Frog  1139 SP--LSPSSASISSFHGDESDSISSPGWPK------------TPSSPKASSSTTT--GEKITKLY 1187

  Fly   996 EMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIA 1060
            |:.:.|:|:.|:|:...|||||.||:...|.:.|:||||.|||..|||.||..:|.|:|.|::::
 Frog  1188 ELGNEPERKMWVDRYLTFMEERGTPVANLPAVGKKPLDLVRLYFCVKEIGGLAQVNKNKKWRELS 1252

  Fly  1061 GLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPG--- 1122
            ..|.:|.|||||.:|:|.|.:.|..|||..:||: :|.|.|  ...|..||..| ...|||.   
 Frog  1253 SNLNVGTSSSAASSLKKQYIQYLFAFECKIERGE-EPPPEI--FNPGESKKQPK-IQPPSPANSG 1313

  Fly  1123 ---GGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQ 1184
               |.|    |..||||:           |....:::..|..|..:|:             ||:|
 Frog  1314 SLQGPH----TPQSTGSN-----------SMAEMSLELKPPTPASTPH-------------GQLQ 1350

  Fly  1185 RPPSQNNPQTPHPGAAAAVAAGDN--ISVSNPFEDPIAAGGGPGSGTGPGPGQGPGPGAASGGAG 1247
                      |.||       |.|  :||.:||.|                              
 Frog  1351 ----------PMPG-------GRNSAVSVQDPFSD------------------------------ 1368

  Fly  1248 AVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQHQHPGLPGPPPPQQQQGQQGQQPPPSVGG 1312
                              ...::.|.........|..|...||      ...|:...:|.....|
 Frog  1369 ------------------TSDSSFQKRNSMTPNVPYQQGMNLP------DMMGRMPFEPNKDPFG 1409

  Fly  1313 G--PPPAPQQH--GPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGSPYPSQPGAY---GQ 1370
            |  ..|...:|  .|||:|.|..|.:       |....||..:.:..:....:...||.|   .:
 Frog  1410 GMRKVPGSSEHFMAPGQMPSSNMQDM-------YNQTPSGVMSNIGMSQRQQFSYGPGGYDRRSE 1467

  Fly  1371 YGSSDQYNATGPPGQ----PFGQGPGQYPPQNRNMYPPYGPEGEAPPTGANQYGPYGSRPYSQPP 1431
            ||...: .:.|||||    |....||.|.|   |.|           .|..::.|||.:...|.|
 Frog  1468 YGMGAE-GSMGPPGQNSMAPSNSDPGMYSP---NRY-----------HGQQRHEPYGQQYSGQGP 1517

  Fly  1432 PGGPQPPTQTVAGGPPAGGAPGAPPSSAYPTGRPSQQDYYQPPPDQSPQPRRHPD--FIKDSQPY 1494
            |.| |||.        ||..||.         .|.||:|           :||.|  ::..::.:
 Frog  1518 PSG-QPPY--------AGHQPGM---------YPQQQNY-----------KRHMDSMYVPQAKRH 1553

  Fly  1495 PG--YNARPQIYGAWQSGTQQYRPQYPSSPAPQNWGGAPPRGAAPPPGAPHGPPIQQPAGVAQWD 1557
            .|  ||.:   ||:.|   |....||.:|     :.|...|            |:|        .
 Frog  1554 EGDMYNMQ---YGSQQ---QDMYNQYGNS-----YSGQERR------------PVQ--------G 1587

  Fly  1558 QHRYPPQQGPPPPPQQQQQPQQQQQQPPYQQVAGPPGQQPPQAPPQ---WAQMN----------- 1608
            |:.||..:      ::.|.|.|.||.....|:.|...|.......|   |...|           
 Frog  1588 QYPYPYNR------ERMQGPGQMQQHSMGSQLMGGSMQSSASEGAQQNMWTSRNDMPYSYQVRQG 1646

  Fly  1609 PGQTAQSGIAPPGSPLRPPSGPGQQNRMPGMPAQQQQSQQQGGVPQPPPQQASHGGVPSPGLPQV 1673
            |..|.|:|            .....||...|....|:.....       |.:|||....|     
 Frog  1647 PASTTQTG------------SYSAMNRSDEMMGPDQRMNHDN-------QWSSHGNQRQP----- 1687

  Fly  1674 GPGGMVKPPYAMPPPPSQGVGQQVGQGPPGGMMSQKPPPMPGQ-------AMQQQPLQQQPPSHQ 1731
               ..:.|..||.|         :.:.||...  |.||.||..       |..|:.|:.:....:
 Frog  1688 ---SYMSPTAAMQP---------ITRAPPSSY--QTPPSMPNHISRAPSPASFQRSLENRMSPSK 1738

  Fly  1732 HPHPHQHPQHQHPHQMPPNQTAPGGYGPPGMPGGGAQLVKKELIFPHDSVESTTPVLYRRKRLMK 1796
            .|.   .|..:....:|...|:......|.:|      |::|:.||..|||:|.|:|..|::|..
 Frog  1739 SPF---LPSMKMQKALPTTTTSQSTVTSPQVP------VRREITFPPGSVEATQPILKPRRKLTA 1794

  Fly  1797 ADVCPVDPWRIFMAMRSGLLTECTWALDVLNVLLFDDSTVQFFGISNLPGLLTLLLEHFQKNLAE 1861
            .|:...:.||:.|:::||||.|.|||||.:|:||:|||||..|.:|.|||.|.||:|:|:|.|.:
 Frog  1795 KDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLPGFLELLVEYFRKCLID 1859

  Fly  1862 MFDERENEE-----QSALLAEDADDDADSGTVMCEKLRTSGRQPRCVRSISSYNRRRHYENMDRS 1921
            :|...:..|     |.||                        .|....:.|:.......|..|..
 Frog  1860 IFGILKEYEVGEAVQKAL------------------------SPTTEDTYSAMEEEVSLEYSDTE 1900

  Fly  1922 GKDGAGNGSDSEDADEGIDLGQVRVQPNPEERSLLLSFTPNYTMVTRK--GVPVRIQPAENDIFV 1984
            .:|     .|..|.:|..:| ::..:....:.|.||:.:........|  .:|:::....| :||
 Frog  1901 EED-----DDEYDKEEDDNL-KIEEKGFSYQNSELLTDSSERPKQASKFDKLPIKVVKKSN-LFV 1958

  Fly  1985 DERQ----KAWDIDTNRLYEQLEPVGSDAWTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKK 2045
            .:|.    :..:.::..|:.||.  |.|.                   :|.:...|         
 Frog  1959 IDRSDRLGRVQEFNSGLLHWQLG--GGDT-------------------TEHIQTHF--------- 1993

  Fly  2046 GRKRTELASSSRKPEIKTEENSTEEQTFNKKRRLVSGGSSSSGAHAEGKKSKLTSEEFAQPNAEV 2110
             ..:.|:.|..|.|:                      .|:|.....:|.:....:|...||...:
 Frog  1994 -ESKMEIPSHRRTPQ----------------------SSNSPVKKKKGHEDIAVAEYEEQPEKSI 2035

  Fly  2111 --------KKEPGTADSDCRPVDMDIEAPQQRLTNGVAPCSSTPAIFDPRTTAKDEARVLQRRRD 2167
                    ...||....|.:...:..|:  .:|:.|:                 .:|:  |.|..
 Frog  2036 TATIDDVLSARPGALPEDSKNDFLQTES--GKLSLGI-----------------HQAK--QHRNI 2079

  Fly  2168 SSFEDECYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLL 2232
            :..|||..:|||..|..::..:||||:|||.:|||.|:|:|||||:|.::|....:.:||:|:||
 Frog  2080 TLLEDEPRSRDEIPLCTIAVWKDSLAKRCICVSNIIRSLSFVPGNDTEMSKHPGLVLILGKLILL 2144

  Fly  2233 NHEHLRRTPKTRNYDRE-EDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYD 2296
            :|||..|....:.|::: ||.:....|:    :.|||||.|..:|||.||.:|||:|.|:||.|.
 Frog  2145 HHEHPERKRAPQTYEKDGEDNNKGVLCT----KDEWWWDCLEVLRENTLVTLANISGQLDLSAYT 2205

  Fly  2297 ELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFS 2361
            |.|..|::||:|||.|||||..|||||:.||.|.||||||.||.||||.:.|.||||::||||||
 Frog  2206 ESICLPILDGMLHWLVCPSAEAQDPFPTVGPISFLSPQRLVLETLCKLSIQDNNVDLILATPPFS 2270

  Fly  2362 RLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVALQSPCISYLVAFIEQAEQTAL 2426
            |.|||.|.|.|::...::.|.||.||.||..||..|:.:||.:|:|...|..|::|:|.....|.
 Frog  2271 RQEKLYATLVRYVGDRKNPVCREMSVALLSNLAQGDTLVARAIAVQKGSIGNLISFLEDGVTMAQ 2335

  Fly  2427 GVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQQEQRLLGLVMSHILDQQV 2491
            ...:||.:.:: :.|.....|.||:.|||..||.:||..:|:|.|:.||.|||.:.:|.:|:..|
 Frog  2336 YQQSQHNLMHM-QPPHLEPPSADMMCRAAKALLAMAKVEENQSEFLLQEGRLLDISISAVLNTVV 2399

  Fly  2492 ALIISRVLYQVSR 2504
            |.:|..||:|:.:
 Frog  2400 ASVICDVLFQIGQ 2412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 43/91 (47%)
DUF3518 2191..2451 CDD:288854 126/261 (48%)
arid1bXP_004914686.1 Med15 443..>824 CDD:255446 97/401 (24%)
BRIGHT 1193..1284 CDD:128777 43/91 (47%)
DUF3518 2103..2359 CDD:288854 126/261 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112460240
eggNOG 1 0.900 E1_KOG2510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D135670at33208
OrthoFinder 1 1.000 FOG0001960
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.