DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: osa and arid1a

Sequence 1:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_002934685.2 Gene:arid1a XenbaseID:XB-GENE-492490 Length:2053 Species:Xenopus tropicalis

Alignment Length:2721 Identity:748/2722 (27%)
Similarity:1009/2722 (37%) Gaps:905/2722 (33%)


  Fly    18 APAPAATPPSAGAAPGAATP---PTSGPPTPNNNSNNGSDPSIQQQQQNVAPHPYGAPPPPGSG- 78
            |....|:.||.|..|.||.|   .:.|.|.|.:|.:....|.....:.:......|....|.|. 
 Frog     3 AQVAPASGPSLGGTPPAAGPDLKKSPGDPPPPSNESQQEAPVTASNETDSTEAANGTRTVPASSH 67

  Fly    79 --PGGPPGPDPAAVMHYHHLHQQQQQHPPPPHMQQQQHHGG-PAPPPPGGAPEHAPGVKEEYTHL 140
              ||.||....|:            .|||          || ...|.|.|..:..||:  :||  
 Frog    68 QEPGDPPAASSAS------------SHPP----------GGFGFSPYPRGVFQPGPGL--DYT-- 106

  Fly   141 PPPHPHPAYGRYHADPNMDPYRYGQPLPGGKPPQQQQPHPQQQPPQQPGPGGSPNRPPQQRYIPG 205
            ||.   .||..|.|.||       :..|.|.||              |.|..|..:||...|.|.
 Frog   107 PPT---DAYNSYPAYPN-------RAYPPGYPP--------------PRPPVSTGKPPAPAYPPP 147

  Fly   206 QPPQGP------TPTLNSLLQSSNP----PP------PPQHRYANTYDPQQAAASAAAAAAAQQ- 253
            .|..||      |||||.||.:.:|    |.      |.||:.|..|        .|..||.|: 
 Frog   148 PPRFGPPQPAAATPTLNQLLTAPSPGRGYPAYPGGDYPDQHKGAEGY--------TAGWAAGQRG 204

  Fly   254 -QQAGGPPPPGHG------PPPPQHQ-----PSPY----------GGQQGGWAPPPRPYS----- 291
             ...|.|...|.|      |..|..|     |.||          |.|||....|.:|||     
 Frog   205 VHPPGSPGSSGQGLPRTPQPATPMDQMGKMRPQPYGSSNPYSQQQGAQQGHSGYPVQPYSSQSPQ 269

  Fly   292 ---------PQLGPSQQY--------RTPPPTNTSRGQSPY-------PPAHGQNSGSYPSSPQQ 332
                     ||.|.|.||        :..|.:.:.:.||||       ||...|.:.......||
 Frog   270 RYPMSMQGRPQGGMSMQYGQQMSPYTQQGPGSYSQQSQSPYYNQQSLHPPQQPQTTPPQTQYSQQ 334

  Fly   333 QQQQQQQQQQQAGQQPGGPVPGGPPPGTGQQPP-------QQNTPPTSQ-YSPYPQ---RYPTP- 385
            |...|...||||......|...|.|..|.||.|       ||..|.:|| .|||.|   :|.:. 
 Frog   335 QSGPQSYSQQQAPSSQPTPTQSGQPTFTQQQSPSPSPYTQQQGAPTSSQSQSPYTQQTGQYTSTQ 399

  Fly   386 ---PGLPAGGSNHRTAYSTHQYPEPNR------PWPGGSSPSPGSG----------HPLPPASPH 431
               ...|:.|:.....||..::|.|..      .....|:||.||.          .|.|.:.|.
 Frog   400 QQVSSYPSTGAQQSGTYSQQRFPPPQELSQDSFTSQASSTPSLGSSKGQDDLSMGMQPRPSSLPD 464

  Fly   432 -----HVPPLQQQPPPPPHVSAGGPPPSSSPGHAPSPSPQPSQASPSPHQELIGQNSNDSSSGGA 491
                 ...|:..:....|.||..|  .|||.|...:|:..|.....|||.               
 Frog   465 LSGSIDDLPMGAEGALSPGVSTSG--ISSSQGEQSNPAQSPFSPHTSPHL--------------- 512

  Fly   492 HSGMGSGPPGTPNPQQVMRPTPSPTGSSGSRSMSPAVAQNHPISRPASNQSSSGGPMQQPPVGAG 556
                    ||      :..|:|||.||                  |||...|..||:....|...
 Frog   513 --------PG------IRGPSPSPVGS------------------PASVAPSRSGPLSPTAVPGT 545

  Fly   557 GPPPMPP--------HPGMPGGPPQQQQSQQQQASNSASSASNSPQQTPPPAPPPNQGMNNMATP 613
            ..||.||        ||.|......|::...|:  |:......|||  |.||..|.|..      
 Frog   546 QMPPRPPSGQSDGLIHPTMNQASLGQERGYMQR--NAQIPQYGSPQ--PGPALSPRQST------ 600

  Fly   614 PPPPQGAAGGGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYPPRPQY---PPGAYAT 675
                  ||        .||.|.   ||.|......|.||..|..|.|.||.:|.|   |...|: 
 Frog   601 ------AA--------QMHSGM---GPYQQNSMGSYGPQGGQYGPQGGYPRQPNYNTMPNAGYS- 647

  Fly   676 GPPPPPTSQAGAGGANSMPSGAQAGGYPGRGMPNHTGQYPPYQWVPPSPQQTVPGGAPGGAMVGN 740
                       |||...:.:|.|..|.  .|||.:||:.                   |.:.:||
 Frog   648 -----------AGGMTPLVAGGQMHGQ--GGMPQYTGRM-------------------GHSGMGN 680

  Fly   741 HVQG--KGTPPPPVVGGP-PPPQGSGSPRPLNYLKQHLQHKGGYGGSPTPPQGPQGYGNGPTGMH 802
            ...|  .|:.||.|..|. |||.|         :.:..|...|...:|          |......
 Frog   681 RPYGPNMGSMPPQVASGMCPPPAG---------MNRKAQEAAGMHATP----------NSLQSRS 726

  Fly   803 PGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQG---------ASGGPESGGPEHIS 858
            ||.|              ||.       |..|:..|...|||         ..|.|...|     
 Frog   727 PGYP--------------NMN-------QGGMMGSGTAYGQGMNSMAAIMNTQGNPYMSG----- 765

  Fly   859 QDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPY 923
              |.:::||..|:             ||...:.:|....|....:.|.|      ||||......
 Frog   766 --NMVNNSGMAGS-------------PDLMGLPDVKLTPTPKMNNKADG------TPKSETKSKK 809

  Fly   924 SQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKS 988
            |                                                       |:.|||  :
 Frog   810 S-------------------------------------------------------SSSTTT--N 817

  Fly   989 DSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKS 1053
            :.:.||||:...|||:.|:|:..:|.||:...:|..|.:.::||||||||:.|||.||..:|.|:
 Frog   818 EKITKLYELGVEPDRKMWVDRYLSFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKN 882

  Fly  1054 KTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASV 1118
            |.|:::|..|.:|.|||||.:|:|.|.:.|..|||..:||:..|..|....|:   ||.|| ...
 Frog   883 KKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFASAES---KKQAK-IQP 943

  Fly  1119 PSPGGGHLDAG--TTNSTGSSNSQ--DSFPAPPGSAPNAAIDGYPGYPGGSP--YPVASGPQPDY 1177
            |||.|.....|  |..||.||.::  |..|..|.|.|::.:...||....|.  .....|..|.|
 Frog   944 PSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSHMPPMPGMRNNSVGLQEAYDGSDPSY 1008

  Fly  1178 ATAGQMQRPPSQNNPQTPHPGAAAAVAA-----------GDNISVSNPFEDPIAAGGGPGSGTGP 1231
                      .:.|..||:||..|.:..           |:....::||   :.:|.||....|.
 Frog  1009 ----------QKRNSMTPNPGYQADMMGRMPYETGKDPYGNMRKGADPF---MPSGQGPSGTIGD 1060

  Fly  1232 GPGQGPGPGAASGGAGAVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQHQHPGLPGPPPPQ 1296
            ...:|.|||..|.|               ...|.|:....:..|:          ||| ||....
 Frog  1061 PYSRGTGPGMPSLG---------------QRQHYPYGGYDRVRGE----------PGL-GPEGGM 1099

  Fly  1297 QQQGQQGQQPPPSVGGGPPPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGSPY 1361
            ...|.|....|.:...|      .:.||:.|  .|:|  .:.|..||..|:        ..||||
 Frog  1100 GSGGNQQNMMPSNTDSG------MYSPGRYP--QQRH--DSYGNQYPTQGT--------AAGSPY 1146

  Fly  1362 PSQPGAYGQYGSSDQYNATGPPGQPFGQGPGQYPPQN--RNMYPPYGP-----EGE--APPTGAN 1417
            |||                        |.| .|..||  |.|...|||     |||  ..|....
 Frog  1147 PSQ------------------------QNP-LYQQQNYKRPMDGSYGPSPKRHEGELYGGPYSGG 1186

  Fly  1418 QYGPYGSRPYSQPPPGGPQPPTQTVAGGPPAGGAPGAPPSSAYPTGRPSQQDYYQPPPDQSPQPR 1482
            |.|....:|  ||||...|||.   :|.||   .||.||::...               |.||  
 Frog  1187 QAGQNQQQP--QPPPQQQQPPG---SGAPP---TPGQPPAATNA---------------QQPQ-- 1226

  Fly  1483 RHPDFIKDSQPYPGYNARPQIYGAWQSGTQQYRP------QYPSSPAPQNWGGAPPRGAAPP-PG 1540
                     .||..|.      |::..||:: ||      |:|.....:....||...:.|| |.
 Frog  1227 ---------DPYGQYG------GSYPQGTER-RPVASGQNQFPFQFGRERVSAAPSSNSQPPLPS 1275

  Fly  1541 ---APHGPPIQQPAGVAQWD-----QHRYPPQQGPPP-----------PP--------------Q 1572
               :..|...||.   |.|.     .:.|..:.||||           ||              :
 Frog  1276 SVMSNSGEGNQQG---AMWQGRNDMSYNYQGRPGPPPANTQGQGYHSVPPRGEDMMHSDQRLSHE 1337

  Fly  1573 QQQQPQQQQQQPPYQQVAGPPGQQPPQAPPQWAQMNPGQTAQSGIAPPGSPLRPPSGPGQQNRMP 1637
            .|.||...:|||||   ...||....:|||           |||.         .:.|...|.:|
 Frog  1338 GQWQPHVNRQQPPY---VPAPGPAMTRAPP-----------QSGY---------QASPSMPNHLP 1379

  Fly  1638 GMPAQQQQSQQQGGVPQPPPQQASHGGVPSPGLPQVGPGGMVKPPYAMPPPPSQGVGQQVGQGPP 1702
                                      .||||..|:         |......||:.         |
 Frog  1380 --------------------------QVPSPATPR---------PLEAHTSPSKS---------P 1400

  Fly  1703 GGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQMPPNQTAPGGYGPPGMPGGGA 1767
            ...|.:..||:|.             ||..|.|.|.|                            
 Frog  1401 FLKMQKAGPPVPA-------------SHIVPTPTQPP---------------------------- 1424

  Fly  1768 QLVKKELIFPHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRSGLLTECTWALDVLNVLLFD 1832
             |:::::.||..|||:|.|:|..|:||...|:...:.||:.|:::||||.|.|||||.:|:||:|
 Frog  1425 -LIRRDITFPPGSVEATPPLLKPRRRLTAKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYD 1488

  Fly  1833 DSTVQFFGISNLPGLLTLLLEHFQKNLAEMFD-ERENE---------------EQSALLAEDAD- 1880
            |:::..|.:|.|||||.||:|:|::.|.|:|. .||.|               :.|:||:.||: 
 Frog  1489 DNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILREYEVGEHAQKTLLQPFPSDSSSLLSGDAEM 1553

  Fly  1881 ---DDADSGTVMCEKLRTSGRQPRCVRSISSYNRRRHYENMDRSGKDGAGNGSDSEDADEGIDLG 1942
               ||..|.|                                        :|....:.:||::  
 Frog  1554 VDGDDHQSVT----------------------------------------DGDPQSEDEEGLE-- 1576

  Fly  1943 QVRVQPNPEERSLLLSFTPNYTMVTRKG----VPVRIQPAENDIFVDERQKAWDIDTNRLYEQLE 2003
                    |.::....|:.|.....:..    :|:::...| |.||        :|.:....:|:
 Frog  1577 --------ERKAYNTPFSSNEDTQQQSSKFDRLPIKVVSKE-DPFV--------LDCSHQLGRLQ 1624

  Fly  2004 PVGSDA--WTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKKGRKRTELASSSRKPEIKTEEN 2066
            ...|..  |..|..:           .:|.:...|.|  |.:...|:|..:...||:.:|...|:
 Frog  1625 EFESGLLHWRIGGGD-----------TTEHIQTHFER--RPEPPPRRRPPVKRRSREQQIPAAED 1676

  Fly  2067 STEEQTFNKKRRLVSGGSSSSGAHAEGKKSKLTSEEF--AQPNAEVKKEPGTADSDCRPVDMDIE 2129
            :|.                             |.::.  |:|::..::...|.:.||        
 Frog  1677 TTP-----------------------------TIDDVLCARPSSLSQETGETTEEDC-------- 1704

  Fly  2130 APQQRLTNGVAPCSSTPAIFDPRTTAKDEARVLQRRRDSSFEDECYTRDEASLHLVSESQDSLAR 2194
                ..:.|.:|        .||          .|......|||..::||..|..:.:.||:|:|
 Frog  1705 ----EFSLGGSP--------PPR----------NRHGMKILEDEPRSKDETPLCTLEDWQDALSR 1747

  Fly  2195 RCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCS 2259
            ||:.:|||.|:|:|||||:..::|....|.:||:|:||:|:|..|......|::||:.|...||:
 Frog  1748 RCVCISNILRSLSFVPGNDLEMSKHPGLLLLLGKLVLLHHKHPERKQAPLTYEKEEERDQGVSCN 1812

  Fly  2260 SLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPS 2324
                :.|||||.|..:|||.||.:|||:|.|:||.|.|.|..|::||||||||||||..||||.:
 Frog  1813 ----KAEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPILDGLLHWAVCPSAEAQDPFVT 1873

  Fly  2325 CGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNL 2389
            .|||:|||||||.||||.||.:.|:||||::|||||||||||...|.|.|...::.|.||.:|.|
 Frog  1874 LGPNAVLSPQRLVLEALSKLSIQDSNVDLILATPPFSRLEKLYGTLVRFLSDRKNHVCREMAVVL 1938

  Fly  2390 LHYLAAADSAMARTVALQSPCISYLVAFIE------QAEQTALGVANQHGINYLRENPDSMGTSL 2448
            |..||..|:..||.:|||...|..|:.|:|      |.:|:.  .|:.||.:...|     .||.
 Frog  1939 LANLAQGDTLAARAIALQKGSIGNLLGFLEDSLAATQFQQSQ--AAHLHGSSAPFE-----PTST 1996

  Fly  2449 DMLRRAAGTLLHLAKHPDNRSLFMQQEQRLLGLVMSHILDQQVALIISRVLYQVSR 2504
            ||:|||:..||.|||..:|...|...|.|||.:.:|.:::..|:.:|..||:.:.:
 Frog  1997 DMMRRASRALLALAKVEENHPEFTLYEARLLDISVSPLMNCSVSQVICDVLFLIGQ 2052

Known Domains:


GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 42/91 (46%)
DUF3518 2191..2451 CDD:288854 131/266 (49%)
arid1aXP_002934685.2 Med15 152..>588 CDD:255446 131/495 (26%)
BRIGHT 830..921 CDD:128777 42/91 (46%)
DUF3518 1744..1999 CDD:288854 131/266 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112439971
eggNOG 1 0.900 E1_KOG2510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D135670at33208
OrthoFinder 1 1.000 FOG0001960
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.