DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prx3 and Jafrac2

Sequence 1:NP_524387.1 Gene:Prx3 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001261350.1 Gene:Jafrac2 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster

Alignment Length:202 Identity:122/203 (60%)
Similarity:150/203 (74%) Gaps:3/203 (1%)


  Fly    32 HQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERI 96
            ||.....|| :.:|||.|:|.|||:....::.|..|.|||:||.||||||||||||||:|||:||
  Fly    43 HQLQYTKAV-ISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRI 106

  Fly    97 KEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLR 161
            .||..|.|||:||||||||:||.|.|..||.||:|.:|.|||||||.|||.||.|.|:..|.:||
  Fly   107 AEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALR 171

  Fly   162 GTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEES 226
            |.||||..|:|||.::|||||||||||.:||::|||:.:.|||||||.|.|.::  ||.|:.||.
  Fly   172 GLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGAD--TIVPNPEEK 234

  Fly   227 KKYFSKH 233
            .|||:|:
  Fly   235 TKYFAKN 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 119/193 (62%)
PRX_Typ2cys 42..212 CDD:239313 108/170 (64%)
1-cysPrx_C 195..232 CDD:287400 20/37 (54%)
Jafrac2NP_001261350.1 AhpC 51..241 CDD:223527 119/193 (62%)
PRX_Typ2cys 52..223 CDD:239313 109/171 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C295466275
eggNOG 1 0.900 E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I1098
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1326484at2759
OrthoFinder 1 1.000 FOG0000331
orthoMCL 1 0.900 OOG5_126593
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.